Seq-submit ::= { sub { contact { contact { name name { last "Koch" , first "Claudia" , initials "C." } , affil std { affil "Zoologisches Forschungsmuseum Alexander Koenig" , div "Herpetology" , city "Bonn" , sub "NRW" , country "Germany" , street "Adenauerallee 160" , email "c.koch@zfmk.de" , fax "+492289122212" , phone "+492289122234" , postal-code "53113" } } } , cit { authors { names std { { name name { last "Koch" , first "Claudia" , initials "C." } } , { name name { last "Venegas" , first "Pablo" , initials "P.J." } } } , affil std { affil "Zoologisches Forschungsmuseum Alexander Koenig" , div "Herpetology" , city "Bonn" , sub "NRW" , country "Germany" , street "Adenauerallee 160" , postal-code "53113" } } , date std { year 2016 , month 10 , day 17 } } , subtype new , tool "Sequin 15.10 - MS WINDOWS VISTA" } , data entrys { set { class genbank , seq-set { set { class nuc-prot , descr { source { genome genomic , org { taxname "Tantilla tjiasmantoi" , orgname { gcode 1 } } } , pub { pub { gen { cit "Unpublished" , authors { names std { { name name { last "Koch" , first "Claudia" , initials "C." } } , { name name { last "Venegas" , first "Pablo" , initials "P.J." } } } , affil std { affil "Zoologisches Forschungsmuseum Alexander Koenig" , div "Herpetology" , city "Bonn" , sub "NRW" , country "Germany" , street "Adenauerallee 160" , postal-code "53113" } } , title "A large and unusually colored new snake species of the genus Tantilla (Squamata; Colubridae) from the Peruvian Andes" } } } , user { type str "NcbiCleanup" , data { { label str "method" , data str "SequinCleanup" } , { label str "version" , data int 8 } , { label str "month" , data int 10 } , { label str "day" , data int 17 } , { label str "year" , data int 2016 } } } , create-date std { year 2016 , month 10 , day 17 } } , seq-set { seq { id { local str "95238RAG1" } , descr { title "Tantilla tjiasmantoi voucher ZFMK 95238 recombination activating protein 1 (RAG1) gene, partial cds" , molinfo { biomol genomic } , user { type str "StructuredComment" , data { { label str "StructuredCommentPrefix" , data str "##Assembly-Data-START##" } , { label str "StructuredCommentSuffix" , data str "##Assembly-Data-END##" } , { label str "Sequencing Technology" , data str "Sanger dideoxy sequencing" } } } } , inst { repr raw , mol dna , length 1085 , seq-data ncbi4na '8841282822444821484111421118488482824482442212288 848841818141218142848284812888284222288818418814112418488442148188888221111141 228228218412142288881284442182821111221118848841441842881441144188881214442821 221418214844411112114418182442144184442118142882221881888811442188811411842141 282812111181148488812184884888281284418214221441848488212141228442114181884128 881211148221214448148281824211441888884842841418441888428812148884111828888821 821112888848818821188428881228882841842142881888882824818422214211811822841488 888842821428484118821421884848888822828841882212411144114841212111848212142884 884118444418422188221284488288828281411418484288218444444218842841288822888411 841288822112118848412111118414814448441844848211818282222881218841828811111288 841211411418284422144114844282888828288828882821111414228444828228218221284422 218411281418412128888848184418214288821484142282212141842412141448428421448884 288448414288221828222888442821848411141218288828282884221142818888818881128214 848284888211144421288484121881414284884228814488488248214841848221414122284821 21888F28881421414881420'H } , annot { { data ftable { { data cdregion { frame one , code { id 1 } } , partial TRUE , product whole local str "95238RAG1_1" , location int { from 0 , to 1084 , strand minus , id local str "95238RAG1" , fuzz-from lim lt , fuzz-to lim gt } } , { data gene { locus "RAG1" } , partial TRUE , location int { from 0 , to 1084 , strand minus , id local str "95238RAG1" , fuzz-from lim lt , fuzz-to lim gt } } } } } } , seq { id { local str "95238RAG1_1" } , descr { molinfo { biomol peptide , tech concept-trans , completeness no-ends } } , inst { repr raw , mol aa , length 361 , seq-data ncbieaa "ANSAKXNVTGSLDITDEQPKATALMSQVPFETDTELNKNSLAREKDVFH MSQREMEAHQANLQHLCRICGGSLKADPYKKCHLVHGPVDEETQALLRKKEKRATSWPDLLVKVFKINVRGDIDTIHP THFCHNCWKVIQRKVSNAPHEAHLLEKEPVEWHPHSTSCDICVTSFRGIKRKNTMLNSQLSKKLRIIAGHTRKISCIR KVKQLNNKSLMKKISNCKQIHLSTKILAIDYPVDFVKSISCQVCEHILADPVETTCKHLFCRVCILKCLKIMGSYCPS CRYPCFPTDLVSPVKSFLSILNNLVLRCPVKGCHEEVFLEKYCQHRSNHKGAESTDSYVYINKGGRPRQHLLSLTRRV " } , annot { { data ftable { { data prot { name { "RAG1" } , desc "recombination activating gene 1" } , partial TRUE , location int { from 0 , to 360 , id local str "95238RAG1_1" , fuzz-from lim lt , fuzz-to lim gt } } } } } } } } , set { class nuc-prot , descr { source { genome genomic , org { taxname "Tantilla tjiasmantoi" , orgname { gcode 1 } } } , pub { pub { gen { cit "Unpublished" , authors { names std { { name name { last "Koch" , first "Claudia" , initials "C." } } , { name name { last "Venegas" , first "Pablo" , initials "P.J." } } } , affil std { affil "Zoologisches Forschungsmuseum Alexander Koenig" , div "Herpetology" , city "Bonn" , sub "NRW" , country "Germany" , street "Adenauerallee 160" , postal-code "53113" } } , title "A large and unusually colored new snake species of the genus Tantilla (Squamata; Colubridae) from the Peruvian Andes" } } } , user { type str "NcbiCleanup" , data { { label str "method" , data str "SequinCleanup" } , { label str "version" , data int 8 } , { label str "month" , data int 10 } , { label str "day" , data int 17 } , { label str "year" , data int 2016 } } } , create-date std { year 2016 , month 10 , day 17 } } , seq-set { seq { id { local str "7726RAG1" } , descr { title "Tantilla tjiasmantoi voucher CORBIDI 7726 recombination activating protein 1 (RAG1) gene, partial cds" , molinfo { biomol genomic } , user { type str "StructuredComment" , data { { label str "StructuredCommentPrefix" , data str "##Assembly-Data-START##" } , { label str "StructuredCommentSuffix" , data str "##Assembly-Data-END##" } , { label str "Sequencing Technology" , data str "Sanger dideoxy sequencing" } } } } , inst { repr raw , mol dna , length 1050 , seq-data ncbi2na '03BEDDADA517FBE3321327B7B1FDE55FCE3C818EFA4B3FF50 02175D38497FC7A93740140FBE28E7CA0A3FC4A9D148D2EA00428CDA4A3A90C9F54F3FC293F083 921DC4030BBF13BEFDC7A3494A3BBD1217A4233E1FC40B512ACB736428FFEE788E8FE7C4BF801F FD3407FEF3D0F9FC5FDE3927CFFDDB3952430D78BFFE749EE0F493EEFFD77E3D460282E1103B44 9FBE0EA8E53D47AF7F77208EE7D3AAA4F9E1FD7F8387F5043EE10038B2AE8EBB433755F13E37C0 07F84208DE94A0BA77FDDFDFDD00897AB75D351E95381C8E11FFECE8D27F4B89751239848AE792 BF9FAE27D4DD5FE9D3B8084DFDDDF94273FF3F074BB7BF40A91FB84F227BE5F2BEF6D2E3B52215 ED13FDFC0'H } , annot { { data ftable { { data cdregion { frame two , code { id 1 } } , partial TRUE , product whole local str "7726RAG1_1" , location int { from 0 , to 1049 , strand minus , id local str "7726RAG1" , fuzz-from lim lt , fuzz-to lim gt } } , { data gene { locus "RAG1" } , partial TRUE , location int { from 0 , to 1049 , strand minus , id local str "7726RAG1" , fuzz-from lim lt , fuzz-to lim gt } } } } } } , seq { id { local str "7726RAG1_1" } , descr { molinfo { biomol peptide , tech concept-trans , completeness no-ends } } , inst { repr raw , mol aa , length 349 , seq-data ncbieaa "KENVTGSLDITDEQPKATALMSQVPFETDTELNKNSLAREKDVFHMSQR EMEAHQANLQHLCRICGGSLKADPYKKCHLVHGPVDEETQALLRKKEKRATSWPDLLVKVFKINVRGDIDTIHPTHFC HNCWKVIQRKVSNAPHEAHLLEKEPVEWHPHSTSCDICVTSFRGIKRKNTMLNSQLSKKLRIIAGHTRKISCIRKVKQ LNNKSLMKKFSNCKQIHLSTKILAIDYPVDFVKSISCQVCEHILADPVETTCKHLFCRVCILKCLKIMGSYCPSCRYP CFPTDLVSPVKSFLSILNNLVLRCPVKGCHEEVFLEKYCQHRSNHKGAESTDSYVYINKGGRPRQH" } , annot { { data ftable { { data prot { name { "RAG1" } , desc "recombination activating gene 1" } , partial TRUE , location int { from 0 , to 348 , id local str "7726RAG1_1" , fuzz-from lim lt , fuzz-to lim gt } } } } } } } } } } } }