MASCOT Search Results

Search metadata
User : protein2
E-mail : protein2@sangon.com
Search title : Submitted from 11743-renshenhepanjun by Mascot Daemon on DELL-PC
MS data file : C:\Users\DELL\Desktop\20161130-LC-MS\shenggong_11743_90min.mgf
Database : complexdatabase (59,551 sequences; 22,351,232 residues)
Timestamp : 5 Dec 2016 at 07:02:24 GMT
Repeat search

[help]

Export

Not what you expected? Try the select summary.

-Search parameters
Type of search : MS/MS Ion Search
Enzyme : Trypsin
Fixed modifications : Carbamidomethyl (C)
Variable modifications : Acetyl (Protein N-term), Deamidated (NQ), Dioxidation (W), Oxidation (M)
Mass values : Monoisotopic
Protein mass : Unrestricted
Peptide mass tolerance : ± 30 ppm
Fragment mass tolerance : ± 0.15 Da
Max missed cleavages : 2
Instrument type : ESI-QUAD-TOF
Number of queries : 24,686

-Score distribution

Peptide score distribution

Peptide score distribution. Ions score is −10log(P), where P is the probability that the observed match is a random event. Individual ions scores > 33 indicate identity or extensive homology (p<0.05).

Protein score distribution for the first 50 proteins

[Deprecated] Score distribution for family members in the first 50 proteins. Protein scores are derived from ions scores as a non-probabilistic basis for ranking protein families.

-Legend
Dupes Expect Rank U 1 2 Peptide
0.037 +2 GAYSLSLR significant
9 +1 GFFLFVEGGR top ranking
6.4e-005 +1 GSSIFGLAPGK significant and top ranking
1.3e-006 +1 X SSGTSYPDVLK peptide is found in all proteins in family member 1
6.2e-007 +1 / VCNYVSWIK peptide is found in some but not all proteins in family member 2
6.4e-005 +1 U GSSIFGLAPGK unique
+2 5.7e-005 +1 LNTLETEEWFFK peptide has two duplicates
0.18 +1 LNTLETEEWFFK duplicate peptide

Right-facing triangle (+) in the Dupes or Rank column indicates content that can be expanded by clicking on it. Down-facing triangle (-) indicates the content is expanded and can be collapsed. For more details about particular columns, see results format help.

Protein Family Summary

Filters

[help]

Show

§ link to

Protein families 1–122 (out of 122)

Page: 1 

-1

AccessionScoreDescription
1gi|1095449307|gb|APA06271.1|1206hypothetical protein sscle_01g010410 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
1.1gi|1095449307|gb|APA06271.1|12068745274 (51)8 (7)0.55
hypothetical protein sscle_01g010410 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
1.1gi|1095449307|gb|APA06271.1|12068745274 (51)8 (7)0.55hypothetical protein sscle_01g010410 [Sclerotinia sclerotiorum 1980 UF-70]

-74 peptide matches (16 non-duplicate, 58 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
1051+3 457.2244 912.4342 912.4341 0.130260.015+1Score > 29 indicates identity
Score > 20 indicates homology		UK.SAFGPSGYK.V
1227+4 468.2508 934.4870 934.4872 -0.200460.0029+1Score > 33 indicates identityUR.QLDIYAGR.G
1234  468.7429 935.4713 935.4712 0.0710230.02+1Score > 33 indicates identity
Score > 18 indicates homology		UR.QLDIYAGR.G + Deamidated (NQ)
4146+29 614.8483 1227.6821 1227.6823 -0.170579.5e-005+1Score > 33 indicates identity
Score > 29 indicates homology		UK.VTSTITIPPGSR.I
8619+2 854.4103 1706.8061 1706.8053 0.510620.00011+1Score > 35 indicates identityUR.ATPYWYEQISHQGK.S
8632+6 854.9204 1707.8263 1707.8250 0.730771.1e-006+1Score > 35 indicates identity
Score > 30 indicates homology		UR.IGGFTGSNLQVAQCEK.N
8637+1 855.4112 1708.8078 1708.8090 -0.710576.2e-005+1Score > 34 indicates identity
Score > 28 indicates homology		UR.IGGFTGSNLQVAQCEK.N + Deamidated (NQ)
8640  855.4172 1708.8199 1708.8090 6.370290.22+1Score > 35 indicates identityUR.IGGFTGSNLQVAQCEK.N + Deamidated (NQ)
9765  616.6299 1846.8680 1846.8657 1.240171+1Score > 34 indicates identity
Score > 30 indicates homology		UK.GDGVTDDTAAINAAISSGGR.C
9766+6 924.4413 1846.8680 1846.8657 1.2501332.6e-012+1Score > 34 indicates identity
Score > 29 indicates homology		UK.GDGVTDDTAAINAAISSGGR.C
9784+2 924.9309 1847.8473 1847.8497 -1.320651.1e-005+1Score > 34 indicates identity
Score > 28 indicates homology		UK.GDGVTDDTAAINAAISSGGR.C + Deamidated (NQ)
13704+2 1214.5914 2427.1683 2427.1706 -0.960755.4e-006+1Score > 35 indicates identityUK.YYTQSKPQYNTLSVSSFTSAR.T
13709+2 810.0646 2427.1721 2427.1706 0.600520.0011+1Score > 35 indicates identityUK.YYTQSKPQYNTLSVSSFTSAR.T
13711+1 810.3917 2428.1532 2428.1546 -0.620300.16+1Score > 35 indicates identityUK.YYTQSKPQYNTLSVSSFTSAR.T + Deamidated (NQ)
13713  1215.0858 2428.1571 2428.1546 1.000500.0018+1Score > 35 indicates identityUK.YYTQSKPQYNTLSVSSFTSAR.T + Deamidated (NQ)
22301  1293.2094 3876.6062 3876.6746 -17.6001+2Score > 29 indicates identity
Score > 13 indicates homology		UR.NLVFNNCVTAISMFWDWGWLFQGISINNCQK.G + 3 Deamidated (NQ); 3 Dioxidation (W); Oxidation (M)

+2 subsets and intersections (3 subset proteins in total)

ScoreMassSubset of
gi|154696565|gb|EDN96303.1|631773991.1
hypothetical protein SS1G_01229 [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154696565|gb|EDN96303.1|
gi|156062226|ref|XP_001597035.1|63177399
hypothetical protein SS1G_01229 [Sclerotinia sclerotiorum 1980 UF-70]
gi|507414518|emb|CCD47609.2|515844541.1
glycoside hydrolase family 55 protein [Botrytis cinerea T4]
ScoreMassSubset of
gi|154696565|gb|EDN96303.1|631773991.1hypothetical protein SS1G_01229 [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154696565|gb|EDN96303.1|
gi|156062226|ref|XP_001597035.1|63177399 hypothetical protein SS1G_01229 [Sclerotinia sclerotiorum 1980 UF-70]
gi|507414518|emb|CCD47609.2|515844541.1glycoside hydrolase family 55 protein [Botrytis cinerea T4]

-2

AccessionScoreDescription
Family member distances as a dendrogram1gi|238477235|gb|ACR43470.1|915developmental-specific protein Ssp1 [Sclerotinia minor]
2gi|238477233|gb|ACR43469.1|624developmental-specific protein Ssp1 [Sclerotinia trifoliorum]
3gi|1095456207|gb|APA13162.1|477hypothetical protein sscle_10g079320 [Sclerotinia sclerotiorum 1980 UF-70]
 
Cut threshold

ScoreMassMatchesSequencesemPAI
gi|238477235|gb|ACR43470.1|9153506786 (45)17 (13)5.09
developmental-specific protein Ssp1 [Sclerotinia minor]
gi|238477233|gb|ACR43469.1|6243515166 (31)12 (9)2.86
developmental-specific protein Ssp1 [Sclerotinia trifoliorum]
gi|1095456207|gb|APA13162.1|4773518864 (26)13 (9)2.53
hypothetical protein sscle_10g079320 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|1095456207|gb|APA13162.1|
gi|154699467|gb|EDN99205.1|4773518864 (26)13 (9)2.53
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|156031287|ref|XP_001584968.1|4773518864 (26)13 (9)2.53
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|238477227|gb|ACR43466.1|4773518864 (26)13 (9)2.53
developmental-specific protein Ssp1 [Sclerotinia sclerotiorum]
ScoreMassMatchesSequencesemPAI
gi|238477235|gb|ACR43470.1|9153506786 (45)17 (13)5.09developmental-specific protein Ssp1 [Sclerotinia minor]
gi|238477233|gb|ACR43469.1|6243515166 (31)12 (9)2.86developmental-specific protein Ssp1 [Sclerotinia trifoliorum]
gi|1095456207|gb|APA13162.1|4773518864 (26)13 (9)2.53hypothetical protein sscle_10g079320 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|1095456207|gb|APA13162.1|
gi|154699467|gb|EDN99205.1|4773518864 (26)13 (9)2.53predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|156031287|ref|XP_001584968.1|4773518864 (26)13 (9)2.53predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|238477227|gb|ACR43466.1|4773518864 (26)13 (9)2.53developmental-specific protein Ssp1 [Sclerotinia sclerotiorum]

-99 peptide matches (47 non-duplicate, 52 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankU123Peptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankU123Peptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankU123Peptide
67+2 364.7006 727.3867 727.3864 0.340440.0012+1Score > 27 indicates identityUX K.IPDEVR.K
283  396.2241 790.4336 790.4337 -0.23070.51+1Score > 32 indicates identity
Score > 17 indicates homology		U X K.HGTPVIPA.-
311+1 398.7397 795.4648 795.4643 0.650260.037+1Score > 27 indicates identity
Score > 24 indicates homology		UXXXK.ITLFFR.N
408+1 409.2338 816.4530 816.4527 0.270510.00037+1Score > 34 indicates identity
Score > 30 indicates homology		UXXXK.MGIVEIR.R
484+2 417.2311 832.4477 832.4477 0.0790410.0035+1Score > 33 indicates identity
Score > 29 indicates homology		UXXXK.MGIVEIR.R + Oxidation (M)
649  428.7478 855.4810 855.4814 -0.411121.3+2Score > 29 indicates identity
Score > 26 indicates homology		UX K.IPDEVRK.G
688  431.7372 861.4599 861.4443 18.011110+8Score > 34 indicates identityUX XK.DKQLTEK.V + Deamidated (NQ)
1110+5 459.7482 917.4818 917.4818 0.0570530.00065+1Score > 34 indicates identityUX XK.LGATSVENK.I
4444+3 626.3202 1250.6258 1250.6295 -2.970290.0054+1Score > 34 indicates identity
Score > 19 indicates homology		UXXXK.DGSVHLFYVSK  
4453+3 417.8854 1250.6342 1250.6295 3.740111+1Score > 34 indicates identity
Score > 23 indicates homology		UXXXK.DGSVHLFYVSK  
6035+3 705.8466 1409.6786 1409.6714 5.060636e-005+1Score > 34 indicates identityUXXXK.EEELINFFPGSK.L + Deamidated (NQ)
6312+2 719.3576 1436.7006 1436.7003 0.210439.5e-005+1Score > 34 indicates identity
Score > 15 indicates homology		UXXXK.VQATTPLACTMTK.D + Oxidation (M)
6410+3 724.3474 1446.6803 1446.6813 -0.721623.9e-005+1Score > 33 indicates identity
Score > 30 indicates homology		UX R.MKGDNPIWEDVK.I + Oxidation (M)
6413  483.2345 1446.6817 1446.6813 0.25180.31+1Score > 34 indicates identity
Score > 16 indicates homology		UX R.MKGDNPIWEDVK.I + Oxidation (M)
7224+1 513.5968 1537.7686 1537.7664 1.421160.048+1Score > 34 indicates identity
Score > 15 indicates homology		UXXXK.KEEELINFFPGSK.L + Deamidated (NQ)
7225+1 769.8916 1537.7686 1537.7664 1.471801.3e-006+1Score > 34 indicates identityUXXXK.KEEELINFFPGSK.L + Deamidated (NQ)
8253  832.9207 1663.8269 1663.8273 -0.271250.52+1Score > 35 indicates identityUXXXK.DKVQATTPLACTMTK.D
8444+2 560.9475 1679.8207 1679.8222 -0.921160.047+1Score > 35 indicates identity
Score > 15 indicates homology		UXXXK.DKVQATTPLACTMTK.D + Oxidation (M)
8445+1 840.9178 1679.8210 1679.8222 -0.731559.3e-006+1Score > 35 indicates identity
Score > 17 indicates homology		UXXXK.DKVQATTPLACTMTK.D + Oxidation (M)
8452  841.4093 1680.8040 1680.8063 -1.321390.0017+1Score > 34 indicates identity
Score > 24 indicates homology		UXXXK.DKVQATTPLACTMTK.D + Deamidated (NQ); Oxidation (M)
9878  929.4593 1856.9040 1856.9091 -2.72011+2Score > 34 indicates identity
Score > 14 indicates homology		U XK.WGDELPGTALACVIGNGK.I
10075+1 627.9845 1880.9317 1880.9268 2.57150.32+1Score > 35 indicates identity
Score > 13 indicates homology		UX K.GDNPIWEDVKIPDEVR.K
10076+1 941.4784 1880.9422 1880.9268 8.181676.2e-006+1Score > 35 indicates identity
Score > 27 indicates homology		UX K.GDNPIWEDVKIPDEVR.K
11703+3 1050.5046 2098.9947 2098.9919 1.330762.5e-007+1Score > 35 indicates identity
Score > 22 indicates homology		UXX R.NLNPVNEVGTLENDNGSWK.H
11704  700.6726 2098.9958 2098.9919 1.850260.37+1Score > 35 indicates identityUXX R.NLNPVNEVGTLENDNGSWK.H
11716+1 701.0009 2099.9807 2099.9760 2.270170.027+1Score > 34 indicates identity
Score > 14 indicates homology		UXX R.NLNPVNEVGTLENDNGSWK.H + Deamidated (NQ)
11718+3 1050.9995 2099.9845 2099.9760 4.060851.9e-007+1Score > 34 indicates identity
Score > 30 indicates homology		UXX R.NLNPVNEVGTLENDNGSWK.H + Deamidated (NQ)
11719  1050.9998 2099.9850 2099.9760 4.290600.00013+1Score > 34 indicates identityUXX R.NLNPVNEVGTLENDNGSWK.H + Deamidated (NQ)
12126  540.0220 2156.0590 2156.0572 0.852111+1Score > 35 indicates identity
Score > 23 indicates homology		UX R.MKGDNPIWEDVKIPDEVR.K + Oxidation (M)
12128+1 719.6939 2156.0599 2156.0572 1.262370.00064+1Score > 35 indicates identity
Score > 18 indicates homology		UX R.MKGDNPIWEDVKIPDEVR.K + Oxidation (M)
12130+1 1079.0376 2156.0606 2156.0572 1.602621.9e-006+1Score > 35 indicates identity
Score > 17 indicates homology		UX R.MKGDNPIWEDVKIPDEVR.K + Oxidation (M)
13781+1 817.0704 2448.1895 2448.1995 -4.102400.021+1Score > 35 indicates identityU X K.IVHCTDGKKEEELINFFPGSK.L + Deamidated (NQ)
13783+1 613.0568 2448.1982 2448.1995 -0.54251+1Score > 35 indicates identity
Score > 18 indicates homology		U X K.IVHCTDGKKEEELINFFPGSK.L + Deamidated (NQ)
15858  1396.6388 2791.2630 2791.2627 0.130885.8e-009+1Score > 34 indicates identity
Score > 19 indicates homology		U XK.LTSGSFNQGTGWNPNGSQWAYFSASK.D
15881+1 1397.1307 2792.2469 2792.2467 0.0910644.5e-005+1Score > 33 indicates identityU XK.LTSGSFNQGTGWNPNGSQWAYFSASK.D + Deamidated (NQ)
15883+1 1397.1326 2792.2506 2792.2467 1.400310.11+1Score > 34 indicates identityU XK.LTSGSFNQGTGWNPNGSQWAYFSASK.D + Deamidated (NQ)
15885  931.7579 2792.2520 2792.2467 1.890101+1Score > 34 indicates identity
Score > 22 indicates homology		U XK.LTSGSFNQGTGWNPNGSQWAYFSASK.D + Deamidated (NQ)
15896  1398.1409 2794.2672 2794.2147 18.80151+1Score > 34 indicates identity
Score > 27 indicates homology		U XK.LTSGSFNQGTGWNPNGSQWAYFSASK.D + 3 Deamidated (NQ)
20756  1765.3870 3528.7594 3528.7559 0.99061+1Score > 35 indicates identity
Score > 19 indicates homology		UXXXM.SLLTTELACTSAPDQVLHLFFQDGQNILEAR.S + Acetyl (Protein N-term)
20757+5 1177.2605 3528.7597 3528.7559 1.080111+1Score > 35 indicates identity
Score > 24 indicates homology		UXXXM.SLLTTELACTSAPDQVLHLFFQDGQNILEAR.S + Acetyl (Protein N-term)
20761  883.1984 3528.7646 3528.7559 2.48021+1Score > 35 indicates identity
Score > 15 indicates homology		UXXXM.SLLTTELACTSAPDQVLHLFFQDGQNILEAR.S + Acetyl (Protein N-term)
20775  1765.8892 3529.7638 3529.7399 6.770121+1Score > 35 indicates identity
Score > 24 indicates homology		UXXXM.SLLTTELACTSAPDQVLHLFFQDGQNILEAR.S + Acetyl (Protein N-term); Deamidated (NQ)
20776  1177.5991 3529.7755 3529.7399 10.1041+1Score > 35 indicates identity
Score > 16 indicates homology		UXXXM.SLLTTELACTSAPDQVLHLFFQDGQNILEAR.S + Acetyl (Protein N-term); Deamidated (NQ)
20777+1 1765.9131 3529.8116 3529.7399 20.30320.088+1Score > 34 indicates identityUXXXM.SLLTTELACTSAPDQVLHLFFQDGQNILEAR.S + Acetyl (Protein N-term); Deamidated (NQ)
20782+1 1177.9279 3530.7618 3530.7239 10.70171+1Score > 35 indicates identity
Score > 29 indicates homology		UXXXM.SLLTTELACTSAPDQVLHLFFQDGQNILEAR.S + Acetyl (Protein N-term); 2 Deamidated (NQ)
20784  883.6993 3530.7683 3530.7239 12.6011+1Score > 35 indicates identity
Score > 14 indicates homology		UXXXM.SLLTTELACTSAPDQVLHLFFQDGQNILEAR.S + Acetyl (Protein N-term); 2 Deamidated (NQ)
21371  1212.5996 3634.7770 3634.7647 3.38001+1Score > 35 indicates identity
Score > 13 indicates homology		UXXX-.MSLLTTELACTSAPDQVLHLFFQDGQNILEAR.S + Deamidated (NQ); Oxidation (M)

+2 subsets and intersections (3 subset proteins in total)

ScoreMassSubset of
gi|238477229|gb|ACR43467.1|210355652.1, 2.2
developmental-specific protein Ssp1 [Botrytis cinerea]
+1 sameset of gi|238477229|gb|ACR43467.1|
gi|347837504|emb|CCD52076.1|21035565
hypothetical protein BofuT4_P082350.1 [Botrytis cinerea T4]
gi|347837689|emb|CCD52261.1|26711062.1
similar to ferric reductase like transmembrane component [Botrytis cinerea T4]
ScoreMassSubset of
gi|238477229|gb|ACR43467.1|210355652.1, 2.2developmental-specific protein Ssp1 [Botrytis cinerea]
+1 sameset of gi|238477229|gb|ACR43467.1|
gi|347837504|emb|CCD52076.1|21035565 hypothetical protein BofuT4_P082350.1 [Botrytis cinerea T4]
gi|347837689|emb|CCD52261.1|26711062.1similar to ferric reductase like transmembrane component [Botrytis cinerea T4]

-3

AccessionScoreDescription
1gi|154693286|gb|EDN93024.1|525hypothetical protein SS1G_08889 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
3.1gi|154693286|gb|EDN93024.1|5258100037 (23)11 (9)0.74
hypothetical protein SS1G_08889 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154693286|gb|EDN93024.1|
gi|156048316|ref|XP_001590125.1|5258100037 (23)11 (9)0.74
hypothetical protein SS1G_08889 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095458308|gb|APA15259.1|5258100037 (23)11 (9)0.74
hypothetical protein sscle_14g100290 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
3.1gi|154693286|gb|EDN93024.1|5258100037 (23)11 (9)0.74hypothetical protein SS1G_08889 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154693286|gb|EDN93024.1|
gi|156048316|ref|XP_001590125.1|5258100037 (23)11 (9)0.74hypothetical protein SS1G_08889 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095458308|gb|APA15259.1|5258100037 (23)11 (9)0.74hypothetical protein sscle_14g100290 [Sclerotinia sclerotiorum 1980 UF-70]

-37 peptide matches (18 non-duplicate, 19 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
37+1 359.7103 717.4060 717.4061 -0.200310.085+1Score > 33 indicates identityUK.LDFVPK.R
65+1 364.6859 727.3573 727.3575 -0.170220.095+1Score > 27 indicates identity
Score > 25 indicates homology		UK.SMFISK.L + Oxidation (M)
1164+1 464.2274 926.4403 926.4399 0.420350.0058+1Score > 30 indicates identity
Score > 25 indicates homology		UK.WGVWDHK.F
2204+1 527.7831 1053.5517 1053.5529 -1.090575.3e-006+1Score > 31 indicates identity
Score > 16 indicates homology		UR.STFLMTVAGK.V
2353+2 535.7813 1069.5479 1069.5478 0.150480.00047+1Score > 31 indicates identity
Score > 27 indicates homology		UR.STFLMTVAGK.V + Oxidation (M)
2427+1 538.7925 1075.5705 1075.5695 0.910754.7e-006+1Score > 34 indicates identityUK.GIIAIEAMSR.I + Oxidation (M)
5285+3 665.3627 1328.7109 1328.7089 1.540510.0011+1Score > 34 indicates identityUK.LATWIGVTPTDR.A
8516  847.4213 1692.8280 1692.8254 1.530410.014+1Score > 35 indicates identityUK.AVNGMSFQSGQDVVVR.G
8520  847.9128 1693.8110 1693.8094 0.960250.56+1Score > 35 indicates identityUK.AVNGMSFQSGQDVVVR.G + Deamidated (NQ)
8639+3 855.4171 1708.8195 1708.8203 -0.440922.6e-009+1Score > 35 indicates identity
Score > 19 indicates homology		UK.AVNGMSFQSGQDVVVR.G + Oxidation (M)
8657+2 855.9091 1709.8036 1709.8043 -0.430672.4e-006+1Score > 34 indicates identity
Score > 23 indicates homology		UK.AVNGMSFQSGQDVVVR.G + Deamidated (NQ); Oxidation (M)
8662+1 856.4025 1710.7904 1710.7883 1.210370.025+1Score > 33 indicates identityUK.AVNGMSFQSGQDVVVR.G + 2 Deamidated (NQ); Oxidation (M)
12783+1 752.7229 2255.1469 2255.1434 1.550370.00049+1Score > 35 indicates identity
Score > 16 indicates homology		UK.FAVDSLAAGGQDYLTITSLSAR.Q
12784  1128.5809 2255.1473 2255.1434 1.750490.0019+1Score > 34 indicates identityUK.FAVDSLAAGGQDYLTITSLSAR.Q
13063+1 1152.0801 2302.1456 2302.1456 -0.00960410.013+1Score > 35 indicates identityUR.QAFGAVQLCGTPDKPYYFLK.E
13916  823.7636 2468.2688 2468.2587 4.100220.012+1Score > 34 indicates identity
Score > 15 indicates homology		UK.LAYQDSTGHGLLYNLYADTLLK.L
15265+1 1357.1290 2712.2435 2712.2377 2.140380.029+1Score > 35 indicates identityUR.IYDMQSEYYPTIANAYGVQLDSR.N + Oxidation (M)
15268  905.0889 2712.2448 2712.2377 2.600101+1Score > 35 indicates identity
Score > 22 indicates homology		UR.IYDMQSEYYPTIANAYGVQLDSR.N + Oxidation (M)

+1 subset or intersection (1 subset protein in total)

ScoreMassSubset of
gi|347832971|emb|CCD48668.1|163814303.1
similar to glutaminase [Botrytis cinerea T4]
ScoreMassSubset of
gi|347832971|emb|CCD48668.1|163814303.1similar to glutaminase [Botrytis cinerea T4]

-4

AccessionScoreDescription
Family member distances as a dendrogram1gi|347830055|emb|CCD45752.1|513glycoside hydrolase family 92 protein [Botrytis cinerea T4]
2gi|1095450133|gb|APA07096.1|338hypothetical protein sscle_02g018660 [Sclerotinia sclerotiorum 1980 UF-70]
 
Cut threshold

ScoreMassMatchesSequencesemPAI
gi|347830055|emb|CCD45752.1|5138625616 (11)7 (4)0.16
glycoside hydrolase family 92 protein [Botrytis cinerea T4]
gi|1095450133|gb|APA07096.1|3388550417 (11)9 (6)0.25
hypothetical protein sscle_02g018660 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|1095450133|gb|APA07096.1|
gi|154701986|gb|EDO01725.1|3388503017 (11)9 (6)0.25
hypothetical protein SS1G_04200 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156056939|ref|XP_001594393.1|3388503017 (11)9 (6)0.25
hypothetical protein SS1G_04200 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
gi|347830055|emb|CCD45752.1|5138625616 (11)7 (4)0.16glycoside hydrolase family 92 protein [Botrytis cinerea T4]
gi|1095450133|gb|APA07096.1|3388550417 (11)9 (6)0.25hypothetical protein sscle_02g018660 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|1095450133|gb|APA07096.1|
gi|154701986|gb|EDO01725.1|3388503017 (11)9 (6)0.25hypothetical protein SS1G_04200 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156056939|ref|XP_001594393.1|3388503017 (11)9 (6)0.25hypothetical protein SS1G_04200 [Sclerotinia sclerotiorum 1980 UF-70]

-23 peptide matches (13 non-duplicate, 10 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankU12Peptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankU12Peptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankU12Peptide
884+1 445.2625 888.5104 888.5069 3.950420.0019+1Score > 32 indicates identity
Score > 27 indicates homology		UXXR.VGISWISK.E
988  451.7602 901.5058 901.5021 4.100330.07+1Score > 34 indicates identityUXXR.SLIDIWR  
2431  539.2246 1076.4345 1076.4345 0.00740230.0072+1Score > 26 indicates identity
Score > 15 indicates homology		U XR.HDGYMPDAR.S + Oxidation (M)
3842  601.8176 1201.6206 1201.6204 0.190420.0026+1Score > 34 indicates identity
Score > 28 indicates homology		U XK.SVWNNQVLSR.I
3866  602.8071 1203.5996 1203.5884 9.31041.5+4Score > 34 indicates identity
Score > 18 indicates homology		U XK.SVWNNQVLSR.I + 2 Deamidated (NQ)
5117  656.3196 1310.6247 1310.6255 -0.600270.007+1Score > 32 indicates identity
Score > 18 indicates homology		UXXR.AVPDQGSVGYYR.A
7609+1 791.8676 1581.7205 1581.7246 -2.540653.4e-005+1Score > 33 indicates identityU XR.GQINWNDGYAAMVK.D + Oxidation (M)
8745+3 861.9179 1721.8213 1721.8220 -0.4501017.8e-010+1Score > 35 indicates identity
Score > 22 indicates homology		UXXR.TQGGSNADNVLADAYVK.G
13510+3 1196.5623 2391.1100 2391.1078 0.9101101.9e-009+1Score > 35 indicates identityUX K.TLTITSTGGDGNGDSNYYVQSLK.V + Deamidated (NQ)
24303  1651.7690 4952.2853 4952.3736 -17.8130.99+1Score > 34 indicates identity
Score > 16 indicates homology		U XK.SVWNNQVLSRITTTSTNSTNLGLLYTSMYFMNLLPTNQTGENPK.W + 4 Deamidated (NQ)

-5

AccessionScoreDescription
1gi|154699986|gb|EDN99724.1|463hypothetical protein SS1G_02582 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
5.1gi|154699986|gb|EDN99724.1|4638273217 (14)9 (9)0.42
hypothetical protein SS1G_02582 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154699986|gb|EDN99724.1|
gi|156060879|ref|XP_001596362.1|4638273217 (14)9 (9)0.42
hypothetical protein SS1G_02582 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095451833|gb|APA08794.1|4638675417 (14)9 (9)0.40
hypothetical protein sscle_04g035640 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
5.1gi|154699986|gb|EDN99724.1|4638273217 (14)9 (9)0.42hypothetical protein SS1G_02582 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154699986|gb|EDN99724.1|
gi|156060879|ref|XP_001596362.1|4638273217 (14)9 (9)0.42hypothetical protein SS1G_02582 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095451833|gb|APA08794.1|4638675417 (14)9 (9)0.40hypothetical protein sscle_04g035640 [Sclerotinia sclerotiorum 1980 UF-70]

-17 peptide matches (11 non-duplicate, 6 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
54  363.1950 724.3755 724.3755 -0.110280.025+1Score > 28 indicates identity
Score > 24 indicates homology		UK.LSSGSFK.A
3362+1 581.7907 1161.5669 1161.5666 0.250420.0026+1Score > 35 indicates identity
Score > 29 indicates homology		UK.ELPELAGDYR.T
3743+1 597.3301 1192.6456 1192.6452 0.350843.2e-007+1Score > 32 indicates identity
Score > 32 indicates homology		UR.FSTLATSTIPR.L
6256  716.3920 1430.7694 1430.7657 2.6001171.7e-010+1Score > 33 indicates identity
Score > 32 indicates homology		UK.APTLEALLYDPTK.A
8763+1 862.8932 1723.7718 1723.7723 -0.290814.5e-008+1Score > 33 indicates identity
Score > 20 indicates homology		UK.ADGSTLDVTFNCPAGAK.A + Deamidated (NQ)
9207+1 890.4316 1778.8486 1778.8475 0.620220.028+1Score > 35 indicates identity
Score > 19 indicates homology		UR.VENYVPPYLSGDNANK.R
9742  923.9591 1845.9035 1845.9043 -0.430610.00014+1Score > 35 indicates identityUR.MLHLDNTGFVAGATQQK.L + Oxidation (M)
9784  924.9309 1847.8473 1847.8724 -13.60122.1+2Score > 34 indicates identity
Score > 28 indicates homology		UR.MLHLDNTGFVAGATQQK.L + 2 Deamidated (NQ); Oxidation (M)
10054+1 940.4176 1878.8206 1878.8595 -20.71631.2e-006+1Score > 32 indicates identity
Score > 17 indicates homology		UR.SSTDASLTGKDWSEPGNK.L
12117+1 1079.0186 2156.0225 2156.0208 0.810590.0001+1Score > 35 indicates identity
Score > 31 indicates homology		UR.IQPLSANPTWELDSMPEGR.G + Oxidation (M)
12123  719.6828 2156.0266 2156.0208 2.68031+1Score > 35 indicates identity
Score > 16 indicates homology		UR.IQPLSANPTWELDSMPEGR.G + Oxidation (M)

+1 subset or intersection (1 subset protein in total)

ScoreMassSubset of
gi|347833387|emb|CCD49084.1|254866285.1
carbohydrate-Binding Module family 18 protein [Botrytis cinerea T4]
ScoreMassSubset of
gi|347833387|emb|CCD49084.1|254866285.1carbohydrate-Binding Module family 18 protein [Botrytis cinerea T4]

-6

AccessionScoreDescription
1gi|154697664|gb|EDN97402.1|448hypothetical protein SS1G_11927 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
6.1gi|154697664|gb|EDN97402.1|4487068914 (11)4 (4)0.37
hypothetical protein SS1G_11927 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154697664|gb|EDN97402.1|
gi|156039581|ref|XP_001586898.1|4487068914 (11)4 (4)0.37
hypothetical protein SS1G_11927 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095457316|gb|APA14269.1|4487068914 (11)4 (4)0.37
hypothetical protein sscle_12g090390 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
6.1gi|154697664|gb|EDN97402.1|4487068914 (11)4 (4)0.37hypothetical protein SS1G_11927 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154697664|gb|EDN97402.1|
gi|156039581|ref|XP_001586898.1|4487068914 (11)4 (4)0.37hypothetical protein SS1G_11927 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095457316|gb|APA14269.1|4487068914 (11)4 (4)0.37hypothetical protein sscle_12g090390 [Sclerotinia sclerotiorum 1980 UF-70]

-14 peptide matches (10 non-duplicate, 4 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
1567  490.2279 978.4412 978.4406 0.560380.0048+1Score > 32 indicates identity
Score > 28 indicates homology		UK.LDYNNPSR.R + Deamidated (NQ)
2512  543.2772 1084.5399 1084.5401 -0.150240.021+1Score > 31 indicates identity
Score > 19 indicates homology		UK.YTTNTITSGK.K
9299  895.8873 1789.7600 1789.7618 -0.990823.4e-007+1Score > 30 indicates identityUR.ACWGNGFSIATDFDTK.N + Deamidated (NQ)
9516+1 908.4237 1814.8329 1814.8329 -0.03501006.2e-010+1Score > 33 indicates identity
Score > 20 indicates homology		UR.AEVQNGCGINNNNGNIK.S
9522+2 908.9150 1815.8154 1815.8169 -0.840901.1e-007+1Score > 33 indicates identityUR.AEVQNGCGINNNNGNIK.S + Deamidated (NQ)
9523  908.9153 1815.8161 1815.8169 -0.450729.4e-007+1Score > 33 indicates identity
Score > 24 indicates homology		UR.AEVQNGCGINNNNGNIK.S + Deamidated (NQ)
9525+1 909.4073 1816.8000 1816.8009 -0.510652.7e-005+1Score > 32 indicates identityUR.AEVQNGCGINNNNGNIK.S + 2 Deamidated (NQ)
9526  909.4073 1816.8001 1816.8009 -0.440430.00018+1Score > 32 indicates identity
Score > 18 indicates homology		UR.AEVQNGCGINNNNGNIK.S + 2 Deamidated (NQ)
9528  909.4078 1816.8010 1816.8009 0.0320602.6e-006+1Score > 32 indicates identity
Score > 17 indicates homology		UR.AEVQNGCGINNNNGNIK.S + 2 Deamidated (NQ)
9534  909.8947 1817.7749 1817.7850 -5.550591.1e-005+1Score > 30 indicates identity
Score > 22 indicates homology		UR.AEVQNGCGINNNNGNIK.S + 3 Deamidated (NQ)

+1 subset or intersection (1 subset protein in total)

ScoreMassSubset of
gi|347835694|emb|CCD50266.1|82716746.1
hypothetical protein BofuT4_P092250.1 [Botrytis cinerea T4]
ScoreMassSubset of
gi|347835694|emb|CCD50266.1|82716746.1hypothetical protein BofuT4_P092250.1 [Botrytis cinerea T4]

-7

AccessionScoreDescription
1gi|154705171|gb|EDO04910.1|260hypothetical protein SS1G_07393 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
7.1gi|154705171|gb|EDO04910.1|2608387212 (8)7 (3)0.12
hypothetical protein SS1G_07393 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154705171|gb|EDO04910.1|
gi|156051972|ref|XP_001591947.1|2608387212 (8)7 (3)0.12
hypothetical protein SS1G_07393 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095453223|gb|APA10182.1|2609618012 (8)7 (3)0.11
hypothetical protein sscle_06g049520 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
7.1gi|154705171|gb|EDO04910.1|2608387212 (8)7 (3)0.12hypothetical protein SS1G_07393 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154705171|gb|EDO04910.1|
gi|156051972|ref|XP_001591947.1|2608387212 (8)7 (3)0.12hypothetical protein SS1G_07393 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095453223|gb|APA10182.1|2609618012 (8)7 (3)0.11hypothetical protein sscle_06g049520 [Sclerotinia sclerotiorum 1980 UF-70]

-12 peptide matches (7 non-duplicate, 5 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
685  430.7351 859.4555 859.4552 0.420180.75+1Score > 35 indicates identity
Score > 29 indicates homology		UK.IASWAQGK.V
995  452.7587 903.5028 903.5025 0.280200.32+1Score > 33 indicates identity
Score > 28 indicates homology		UK.STILAGNTK.I
1766  503.7338 1005.4531 1005.4516 1.530250.036+1Score > 31 indicates identity
Score > 23 indicates homology		UK.GFNDQSNPK.A
8390+2 838.3751 1674.7357 1674.7420 -3.790550.00025+1Score > 31 indicates identityUK.EASQGSVGMWDVHTR.I + Oxidation (M)
8867  868.9224 1735.8303 1735.8265 2.20051+1Score > 35 indicates identity
Score > 18 indicates homology		UK.GDGVTDDTAAIQAIFDK.A
10250  632.6757 1895.0052 1895.0040 0.60051+1Score > 33 indicates identity
Score > 17 indicates homology		 R.TKPQYETLPASSFLSVK.S
13459+3 1189.5618 2377.1090 2377.1146 -2.360851.4e-007+1Score > 35 indicates identity
Score > 29 indicates homology		UK.DFGAVGDGVTDDTAAINAAISAGNR.C

-8

AccessionScoreDescription
Family member distances as a dendrogram1gi|154703817|gb|EDO03556.1|231glucan 1,3-beta-glucosidase [Sclerotinia sclerotiorum 1980 UF-70]
2gi|347830866|emb|CCD46563.1|115glycoside hydrolase family 5 protein, partial sequence [Botrytis cinerea T4]
 
Cut threshold

ScoreMassMatchesSequencesemPAI
gi|154703817|gb|EDO03556.1|2314661120 (10)9 (6)0.61
glucan 1,3-beta-glucosidase [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154703817|gb|EDO03556.1|
gi|156054378|ref|XP_001593115.1|2314661120 (10)9 (6)0.61
glucan 1,3-beta-glucosidase [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095452802|gb|APA09762.1|2314661120 (10)9 (6)0.61
hypothetical protein sscle_05g045320 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347830866|emb|CCD46563.1|1152795514 (5)5 (2)0.40
glycoside hydrolase family 5 protein, partial sequence [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
gi|154703817|gb|EDO03556.1|2314661120 (10)9 (6)0.61glucan 1,3-beta-glucosidase [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154703817|gb|EDO03556.1|
gi|156054378|ref|XP_001593115.1|2314661120 (10)9 (6)0.61glucan 1,3-beta-glucosidase [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095452802|gb|APA09762.1|2314661120 (10)9 (6)0.61hypothetical protein sscle_05g045320 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347830866|emb|CCD46563.1|1152795514 (5)5 (2)0.40glycoside hydrolase family 5 protein, partial sequence [Botrytis cinerea T4]

-31 peptide matches (18 non-duplicate, 13 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankU12Peptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankU12Peptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankU12Peptide
2533  544.2562 1086.4979 1086.4982 -0.25021.3+3Score > 30 indicates identity
Score > 16 indicates homology		U XK.GLSFDYNGSK.V
2580  546.7848 1091.5550 1091.5512 3.470280.0031+1Score > 34 indicates identity
Score > 16 indicates homology		UX K.WLNGFGVGSR.Y
2592+3 547.2763 1092.5381 1092.5352 2.580400.00064+1Score > 34 indicates identity
Score > 20 indicates homology		UX K.WLNGFGVGSR.Y + Deamidated (NQ)
3248+2 576.8408 1151.6671 1151.6662 0.730240.14+1Score > 28 indicates identityUX R.AGLIPQPLTSR.K
5033+1 652.8274 1303.6402 1303.6409 -0.480380.021+1Score > 34 indicates identityUX K.GPITWTQGDTTK.Q
5163+1 658.3604 1314.7061 1314.7031 2.310753.9e-006+1Score > 34 indicates identityUX K.DVGTVDGLLAIDK.V
5501  674.8837 1347.7528 1347.7510 1.310567.2e-006+1Score > 31 indicates identity
Score > 17 indicates homology		UXXK.QTLAAIQTLAYR.Y
6258  716.8746 1431.7346 1431.7358 -0.851550.00049+1Score > 34 indicates identityUX R.KGPITWTQGDTTK.Q
6259  478.2523 1431.7351 1431.7358 -0.471141+1Score > 34 indicates identity
Score > 26 indicates homology		UX R.KGPITWTQGDTTK.Q
6447  726.3646 1450.7147 1450.6940 14.3102.1+4Score > 34 indicates identity
Score > 16 indicates homology		U XR.KGPVTWTQGDTTK.Q + Deamidated (NQ); Dioxidation (W)
9146+1 885.4138 1768.8130 1768.8091 2.210240.46+1Score > 33 indicates identityUX K.WTIVGEFSGAQTDCAK.W
10485  968.9196 1935.8246 1935.8309 -3.27031+1Score > 30 indicates identity
Score > 15 indicates homology		UX R.YDGSYPGSPAVYGSCQTK.D
11306  680.6679 2038.9819 2038.9821 -0.090041+1Score > 35 indicates identity
Score > 16 indicates homology		U XK.VILDVHGAPGSQNGFDNSGR.K
11307+1 1020.4982 2038.9819 2038.9821 -0.0870320.001+1Score > 35 indicates identity
Score > 15 indicates homology		U XK.VILDVHGAPGSQNGFDNSGR.K
11310+2 1020.9899 2039.9652 2039.9661 -0.440470.0035+1Score > 35 indicates identityU XK.VILDVHGAPGSQNGFDNSGR.K + Deamidated (NQ)
11313+2 680.9982 2039.9727 2039.9661 3.230151+1Score > 35 indicates identity
Score > 28 indicates homology		U XK.VILDVHGAPGSQNGFDNSGR.K + Deamidated (NQ)
17639  1488.2529 2974.4913 2974.4634 9.39001+2Score > 35 indicates identity
Score > 13 indicates homology		UXXR.YAPATDVVTGIELLNEPANWALDMGAVK.Q + Deamidated (NQ); Oxidation (M)
17640  992.5055 2974.4946 2974.4634 10.50250.64+1Score > 35 indicates identityUXXR.YAPATDVVTGIELLNEPANWALDMGAVK.Q + Deamidated (NQ); Oxidation (M)

+1 subset or intersection (1 subset protein in total)

ScoreMassSubset of
gi|347830867|emb|CCD46564.1|84163778.1
glycoside hydrolase family 5 protein, partial sequence [Botrytis cinerea T4]
ScoreMassSubset of
gi|347830867|emb|CCD46564.1|84163778.1glycoside hydrolase family 5 protein, partial sequence [Botrytis cinerea T4]

-9

AccessionScoreDescription
Family member distances as a dendrogram1gi|154695005|gb|EDN94743.1|225hypothetical protein SS1G_10617 [Sclerotinia sclerotiorum 1980 UF-70]
2gi|507414541|emb|CCD49819.2|55glycoside hydrolase family 15 protein [Botrytis cinerea T4]
 
Cut threshold

ScoreMassMatchesSequencesemPAI
gi|154695005|gb|EDN94743.1|2257248811 (8)4 (2)0.09
hypothetical protein SS1G_10617 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154695005|gb|EDN94743.1|
gi|156043229|ref|XP_001588171.1|2257248811 (8)4 (2)0.09
hypothetical protein SS1G_10617 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095455401|gb|APA12357.1|2257248811 (8)4 (2)0.09
hypothetical protein sscle_09g071270 [Sclerotinia sclerotiorum 1980 UF-70]
gi|507414541|emb|CCD49819.2|55683397 (5)3 (2)0.10
glycoside hydrolase family 15 protein [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
gi|154695005|gb|EDN94743.1|2257248811 (8)4 (2)0.09hypothetical protein SS1G_10617 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154695005|gb|EDN94743.1|
gi|156043229|ref|XP_001588171.1|2257248811 (8)4 (2)0.09hypothetical protein SS1G_10617 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095455401|gb|APA12357.1|2257248811 (8)4 (2)0.09hypothetical protein sscle_09g071270 [Sclerotinia sclerotiorum 1980 UF-70]
gi|507414541|emb|CCD49819.2|55683397 (5)3 (2)0.10glycoside hydrolase family 15 protein [Botrytis cinerea T4]

-13 peptide matches (5 non-duplicate, 8 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankU12Peptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankU12Peptide
220+2 390.2196 778.4246 778.4225 2.760390.008+1Score > 31 indicates identityUXXR.DSALVFK  
428+1 412.2192 822.4238 822.4236 0.270260.099+1Score > 31 indicates identity
Score > 29 indicates homology		UXXK.VVTDSFR.S
1371  478.2511 954.4876 954.4844 3.38003.2+6Score > 31 indicates identity
Score > 18 indicates homology		UX R.ATAMIAYSK.W
1737+1 501.2524 1000.4903 1000.4899 0.410310.017+1Score > 32 indicates identity
Score > 26 indicates homology		U XR.ATAMITYSK.W + Oxidation (M)
7898+4 807.9286 1613.8427 1613.8413 0.870926.2e-009+1Score > 34 indicates identity
Score > 22 indicates homology		UX K.QGSITVTSTSLAFFR.D

-10

AccessionScoreDescription
1gi|1095456302|gb|APA13257.1|212hypothetical protein sscle_10g080270 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
10.1gi|1095456302|gb|APA13257.1|212676128 (4)5 (2)0.10
hypothetical protein sscle_10g080270 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
10.1gi|1095456302|gb|APA13257.1|212676128 (4)5 (2)0.10hypothetical protein sscle_10g080270 [Sclerotinia sclerotiorum 1980 UF-70]

-8 peptide matches (6 non-duplicate, 2 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
23  354.1953 706.3761 706.3762 -0.110121.2+2Score > 31 indicates identity
Score > 25 indicates homology		 R.ALSNFR.A
293  396.7221 791.4297 791.4290 0.940140.52+2Score > 32 indicates identity
Score > 23 indicates homology		 R.AVVNSFR.G
1159  463.7690 925.5235 925.5233 0.300260.12+1Score > 29 indicates identity R.ALQPQIEK.Y
5349+2 668.3492 1334.6838 1334.6830 0.580961.2e-008+1Score > 34 indicates identity
Score > 30 indicates homology		UK.VSGAGNYVVASPSK.A
5357  668.8581 1335.7016 1335.6670 25.90111.2+2Score > 33 indicates identity
Score > 24 indicates homology		UK.VSGAGNYVVASPSK.A + Deamidated (NQ)
6267  717.3283 1432.6421 1432.6412 0.630360.00047+1Score > 32 indicates identity
Score > 15 indicates homology		UK.ANPDYFYTWTR.D

+1 subset or intersection (2 subset proteins in total)

ScoreMassSubset of
gi|154699211|gb|EDN98949.1|1956828110.1
hypothetical protein SS1G_13809 [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154699211|gb|EDN98949.1|
gi|156032806|ref|XP_001585240.1|19568281
hypothetical protein SS1G_13809 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassSubset of
gi|154699211|gb|EDN98949.1|1956828110.1hypothetical protein SS1G_13809 [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154699211|gb|EDN98949.1|
gi|156032806|ref|XP_001585240.1|19568281 hypothetical protein SS1G_13809 [Sclerotinia sclerotiorum 1980 UF-70]

-11

AccessionScoreDescription
1gi|154694741|gb|EDN94479.1|198hypothetical protein SS1G_10353 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
11.1gi|154694741|gb|EDN94479.1|1984792912 (7)7 (4)0.30
hypothetical protein SS1G_10353 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154694741|gb|EDN94479.1|
gi|156044498|ref|XP_001588805.1|1984792912 (7)7 (4)0.30
hypothetical protein SS1G_10353 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095459233|gb|APA16182.1|1984792912 (7)7 (4)0.30
hypothetical protein sscle_16g109520 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
11.1gi|154694741|gb|EDN94479.1|1984792912 (7)7 (4)0.30hypothetical protein SS1G_10353 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154694741|gb|EDN94479.1|
gi|156044498|ref|XP_001588805.1|1984792912 (7)7 (4)0.30hypothetical protein SS1G_10353 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095459233|gb|APA16182.1|1984792912 (7)7 (4)0.30hypothetical protein sscle_16g109520 [Sclerotinia sclerotiorum 1980 UF-70]

-12 peptide matches (7 non-duplicate, 5 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
52  362.1932 722.3719 722.3711 1.030180.17+1Score > 30 indicates identity
Score > 23 indicates homology		UR.QYIGSR.G
695+1 432.7120 863.4095 863.4283 -21.81170.56+1Score > 33 indicates identity
Score > 27 indicates homology		UK.AVTRDMR.Q + Oxidation (M)
1423+1 480.7598 959.5050 959.5036 1.430782.8e-006+1Score > 35 indicates identityUK.TGAGAGAGLTGK.G
2602  547.7593 1093.5041 1093.5040 0.110390.00085+1Score > 32 indicates identity
Score > 21 indicates homology		UR.GVDYQPGGSSK.I
2788+1 556.2623 1110.5101 1110.5094 0.620420.0012+1Score > 31 indicates identity
Score > 26 indicates homology		UK.GNAFFIGDNR.F + Deamidated (NQ)
3540+1 588.8400 1175.6655 1175.6662 -0.631200.19+1Score > 31 indicates identity
Score > 26 indicates homology		UK.FKELGINTVR.V
7348+1 775.8757 1549.7368 1549.7372 -0.290701.6e-005+1Score > 34 indicates identityUR.SIPVGYSAADVDSNR.L

+1 subset or intersection (1 subset protein in total)

ScoreMassSubset of
gi|347835485|emb|CCD50057.1|394800011.1
glycoside hydrolase family 72 protein [Botrytis cinerea T4]
ScoreMassSubset of
gi|347835485|emb|CCD50057.1|394800011.1glycoside hydrolase family 72 protein [Botrytis cinerea T4]

-12

AccessionScoreDescription
1gi|1095455875|gb|APA12830.1|181hypothetical protein sscle_10g076000 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
12.1gi|1095455875|gb|APA12830.1|18111285410 (8)6 (4)0.15
hypothetical protein sscle_10g076000 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
12.1gi|1095455875|gb|APA12830.1|18111285410 (8)6 (4)0.15hypothetical protein sscle_10g076000 [Sclerotinia sclerotiorum 1980 UF-70]

-10 peptide matches (7 non-duplicate, 3 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
172  382.2145 762.4143 762.4024 15.6070.38+1Score > 32 indicates identity
Score > 15 indicates homology		UM.AQSLFR.L + Acetyl (Protein N-term)
4659+1 635.8170 1269.6195 1269.6201 -0.480470.0021+1Score > 32 indicates identityUR.VLVSGSDPEDPR.Y
4833  644.3616 1286.7087 1286.7082 0.410440.00015+1Score > 33 indicates identity
Score > 19 indicates homology		UR.ILDEVTLQTQK.L
8258+1 833.4787 1664.9428 1664.9362 3.990390.00077+1Score > 29 indicates identity
Score > 21 indicates homology		UK.LLPNIPAAVNNFLGGR.T
8670+1 856.4783 1710.9421 1710.9417 0.240566.6e-006+1Score > 31 indicates identity
Score > 16 indicates homology		UR.QINIGGWSIPSTIGIR.F
8680  856.9804 1711.9463 1711.9257 12.00480.0012+1Score > 31 indicates identityUR.QINIGGWSIPSTIGIR.F + Deamidated (NQ)
14483  1292.1826 2582.3507 2582.3170 13.1061+1Score > 33 indicates identity
Score > 19 indicates homology		UR.LGEWPNFPDFTLPGVGPTVGAGGAVK.L

+1 subset or intersection (2 subset proteins in total)

ScoreMassSubset of
gi|154692679|gb|EDN92417.1|1637402712.1
hypothetical protein SS1G_08280 [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154692679|gb|EDN92417.1|
gi|156049147|ref|XP_001590540.1|16374027
hypothetical protein SS1G_08280 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassSubset of
gi|154692679|gb|EDN92417.1|1637402712.1hypothetical protein SS1G_08280 [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154692679|gb|EDN92417.1|
gi|156049147|ref|XP_001590540.1|16374027 hypothetical protein SS1G_08280 [Sclerotinia sclerotiorum 1980 UF-70]

-13

AccessionScoreDescription
1gi|154693130|gb|EDN92868.1|177actin [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
13.1gi|154693130|gb|EDN92868.1|1774184115 (8)9 (5)0.46
actin [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154693130|gb|EDN92868.1|
gi|156048004|ref|XP_001589969.1|1774184115 (8)9 (5)0.46
actin [Sclerotinia sclerotiorum 1980 UF-70]
gi|347833050|emb|CCD48747.1|1774835315 (8)9 (5)0.39
actA, actin [Botrytis cinerea T4]
gi|1095458188|gb|APA15139.1|1774184115 (8)9 (5)0.46
hypothetical protein sscle_14g099090 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
13.1gi|154693130|gb|EDN92868.1|1774184115 (8)9 (5)0.46actin [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154693130|gb|EDN92868.1|
gi|156048004|ref|XP_001589969.1|1774184115 (8)9 (5)0.46actin [Sclerotinia sclerotiorum 1980 UF-70]
gi|347833050|emb|CCD48747.1|1774835315 (8)9 (5)0.39actA, actin [Botrytis cinerea T4]
gi|1095458188|gb|APA15139.1|1774184115 (8)9 (5)0.46hypothetical protein sscle_14g099090 [Sclerotinia sclerotiorum 1980 UF-70]

-15 peptide matches (10 non-duplicate, 5 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
308  398.2399 794.4653 794.4650 0.370180.092+1Score > 26 indicates identity
Score > 20 indicates homology		UK.IIAPPER.K
1144  462.2871 922.5596 922.5600 -0.391220.022+1Score > 25 indicates identity
Score > 18 indicates homology		UK.IIAPPERK.Y
1549  488.7279 975.4412 975.4410 0.180681.2e-005+1Score > 31 indicates identityUK.AGFAGDDAPR.A
3809  400.2398 1197.6974 1197.6982 -0.67050.93+1Score > 31 indicates identity
Score > 17 indicates homology		 R.AVFPSIVGRPR.H
3811+1 599.8568 1197.6991 1197.6982 0.700171+1Score > 31 indicates identity
Score > 29 indicates homology		 R.AVFPSIVGRPR.H
5523  677.8146 1353.6146 1353.6161 -1.071270.18+1Score > 32 indicates identityUK.DSYVGDEAQSKR.G
7014+1 758.8544 1515.6943 1515.6954 -0.700310.078+1Score > 33 indicates identityUK.QEYDESGPSIVHR.K
9302+1 895.9506 1789.8866 1789.8846 1.080549.4e-005+1Score > 35 indicates identity
Score > 26 indicates homology		UK.SYELPDGQVITIGNER.F
10608+2 977.5352 1953.0558 1953.0571 -0.680560.0002+1Score > 32 indicates identityUR.VAPEEHPVLLTEAPINPK.S
14866  883.1101 2646.3085 2646.2370 27.0011.8+9Score > 35 indicates identity
Score > 16 indicates homology		UK.LCYVALDFEQEIQTASQSSSLEK.S + Deamidated (NQ)

+2 subsets and intersections (3 subset proteins in total)

ScoreMassSubset of
gi|224459065|gb|ACN43302.1|752810513.1
actin, partial [Paraphaeosphaeria minitans]
gi|569532343|gb|AHE41160.1|68396613.1
actin, partial [Sclerotinia sclerotiorum]
+1 sameset of gi|569532343|gb|AHE41160.1|
gi|569532395|gb|AHE41186.1|683966
actin, partial [Sclerotinia sclerotiorum]
ScoreMassSubset of
gi|224459065|gb|ACN43302.1|752810513.1actin, partial [Paraphaeosphaeria minitans]
gi|569532343|gb|AHE41160.1|68396613.1actin, partial [Sclerotinia sclerotiorum]
+1 sameset of gi|569532343|gb|AHE41160.1|
gi|569532395|gb|AHE41186.1|683966 actin, partial [Sclerotinia sclerotiorum]

-14

AccessionScoreDescription
1gi|154696190|gb|EDN95928.1|170predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
14.1gi|154696190|gb|EDN95928.1|1703713816 (7)7 (5)0.53
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154696190|gb|EDN95928.1|
gi|156040235|ref|XP_001587104.1|1703713816 (7)7 (5)0.53
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|238477231|gb|ACR43468.1|1703713816 (7)7 (5)0.53
developmental-specific protein Ssp2 [Sclerotinia sclerotiorum]
gi|1095452383|gb|APA09343.1|1703713816 (7)7 (5)0.53
hypothetical protein sscle_05g041130 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
14.1gi|154696190|gb|EDN95928.1|1703713816 (7)7 (5)0.53predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154696190|gb|EDN95928.1|
gi|156040235|ref|XP_001587104.1|1703713816 (7)7 (5)0.53predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|238477231|gb|ACR43468.1|1703713816 (7)7 (5)0.53developmental-specific protein Ssp2 [Sclerotinia sclerotiorum]
gi|1095452383|gb|APA09343.1|1703713816 (7)7 (5)0.53hypothetical protein sscle_05g041130 [Sclerotinia sclerotiorum 1980 UF-70]

-16 peptide matches (9 non-duplicate, 7 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
653+3 428.7535 855.4925 855.4926 -0.120360.013+1Score > 29 indicates identityUK.RPDLISR.L
1070+1 457.7119 913.4091 913.4082 0.980190.4+1Score > 29 indicates identity
Score > 27 indicates homology		UK.DWYFQR.V
1619  492.8011 983.5876 983.5876 0.0441300.01+1Score > 28 indicates identity
Score > 23 indicates homology		UK.KRPDLISR.L
8192+2 828.3629 1654.7113 1654.7145 -1.930530.00031+1Score > 30 indicates identityUK.QPENDVGTMVYSDGK.W + Oxidation (M)
9242  595.2764 1782.8075 1782.8094 -1.111230.57+1Score > 33 indicates identityUR.KQPENDVGTMVYSDGK.W + Oxidation (M)
9244  892.4122 1782.8098 1782.8094 0.201689.6e-007+1Score > 33 indicates identity
Score > 21 indicates homology		UR.KQPENDVGTMVYSDGK.W + Oxidation (M)
12603+1 1110.5179 2219.0213 2219.0238 -1.140520.00099+1Score > 34 indicates identityUK.EEVQPPYQNPTPLACTMTK.N + Oxidation (M)
13333  1174.5653 2347.1161 2347.1188 -1.171161+1Score > 35 indicates identity
Score > 28 indicates homology		UK.KEEVQPPYQNPTPLACTMTK.N + Oxidation (M)
13334  783.3799 2347.1178 2347.1188 -0.42191+1Score > 35 indicates identity
Score > 21 indicates homology		UK.KEEVQPPYQNPTPLACTMTK.N + Oxidation (M)

-15

AccessionScoreDescription
1gi|154705040|gb|EDO04779.1|163hypothetical protein SS1G_07262 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
15.1gi|154705040|gb|EDO04779.1|163238946 (4)2 (2)0.30
hypothetical protein SS1G_07262 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154705040|gb|EDO04779.1|
gi|156051710|ref|XP_001591816.1|163238946 (4)2 (2)0.30
hypothetical protein SS1G_07262 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095453329|gb|APA10288.1|163263016 (4)2 (2)0.27
hypothetical protein sscle_06g050580 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
15.1gi|154705040|gb|EDO04779.1|163238946 (4)2 (2)0.30hypothetical protein SS1G_07262 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154705040|gb|EDO04779.1|
gi|156051710|ref|XP_001591816.1|163238946 (4)2 (2)0.30hypothetical protein SS1G_07262 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095453329|gb|APA10288.1|163263016 (4)2 (2)0.27hypothetical protein sscle_06g050580 [Sclerotinia sclerotiorum 1980 UF-70]

-6 peptide matches (2 non-duplicate, 4 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
2673+4 550.3092 1098.6038 1098.6033 0.480781.2e-006+1Score > 31 indicates identityUR.VDPSVLISNR.Q
4271  618.8359 1235.6572 1235.6550 1.760390.0021+1Score > 32 indicates identity
Score > 25 indicates homology		UR.FGGLTPGEFLAK.W

+1 subset or intersection (1 subset protein in total)

ScoreMassSubset of
gi|347839683|emb|CCD54255.1|1492784615.1
hypothetical protein BofuT4_P129550.1 [Botrytis cinerea T4]
ScoreMassSubset of
gi|347839683|emb|CCD54255.1|1492784615.1hypothetical protein BofuT4_P129550.1 [Botrytis cinerea T4]

-16

AccessionScoreDescription
1gi|154694427|gb|EDN94165.1|161hypothetical protein SS1G_10038 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
16.1gi|154694427|gb|EDN94165.1|1616415613 (6)6 (4)0.22
hypothetical protein SS1G_10038 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154694427|gb|EDN94165.1|
gi|156045687|ref|XP_001589399.1|1616415613 (6)6 (4)0.22
hypothetical protein SS1G_10038 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095448599|gb|APA05563.1|1616415613 (6)6 (4)0.22
hypothetical protein sscle_01g003330 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
16.1gi|154694427|gb|EDN94165.1|1616415613 (6)6 (4)0.22hypothetical protein SS1G_10038 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154694427|gb|EDN94165.1|
gi|156045687|ref|XP_001589399.1|1616415613 (6)6 (4)0.22hypothetical protein SS1G_10038 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095448599|gb|APA05563.1|1616415613 (6)6 (4)0.22hypothetical protein sscle_01g003330 [Sclerotinia sclerotiorum 1980 UF-70]

-13 peptide matches (8 non-duplicate, 5 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
3269  577.8009 1153.5872 1153.5880 -0.640140.42+1Score > 32 indicates identity
Score > 23 indicates homology		UR.LPEFNEHLR.T
3270  385.5366 1153.5880 1153.5880 0.0430180.16+1Score > 32 indicates identity
Score > 23 indicates homology		UR.LPEFNEHLR.T
3677+1 594.3373 1186.6601 1186.6598 0.310530.00047+1Score > 33 indicates identityUK.LAPVTIYDAPK.F
4173  615.8261 1229.6375 1229.6404 -2.330530.00012+1Score > 34 indicates identity
Score > 26 indicates homology		UR.GAAAAEVLWSGAK.D
4457+1 626.8410 1251.6674 1251.6652 1.800582.3e-005+1Score > 32 indicates identity
Score > 24 indicates homology		UK.IFYQGLTPWK.F
5212+2 440.5629 1318.6670 1318.6670 1210.014+1Score > 34 indicates identity
Score > 15 indicates homology		UR.NWYPVEDIKR.T
5214+1 660.3411 1318.6676 1318.6670 0.46191+1Score > 34 indicates identity
Score > 21 indicates homology		UR.NWYPVEDIKR.T
8561  850.9145 1699.8144 1699.8238 -5.50130.64+1Score > 34 indicates identity
Score > 13 indicates homology		UK.DPVTGQNRSQIDAGSR.L

+1 subset or intersection (1 subset protein in total)

ScoreMassSubset of
gi|347838271|emb|CCD52843.1|956988116.1
glycoside hydrolase family 20 protein [Botrytis cinerea T4]
ScoreMassSubset of
gi|347838271|emb|CCD52843.1|956988116.1glycoside hydrolase family 20 protein [Botrytis cinerea T4]

-17

AccessionScoreDescription
1gi|1095450409|gb|APA07372.1|160hypothetical protein sscle_02g021420 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
17.1gi|1095450409|gb|APA07372.1|160646598 (4)6 (3)0.16
hypothetical protein sscle_02g021420 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
17.1gi|1095450409|gb|APA07372.1|160646598 (4)6 (3)0.16hypothetical protein sscle_02g021420 [Sclerotinia sclerotiorum 1980 UF-70]

-8 peptide matches (6 non-duplicate, 2 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
8  351.2133 700.4120 700.4119 0.170190.34+1Score > 33 indicates identity
Score > 27 indicates homology		UR.LAEAGLK.T
3164  571.7828 1141.5510 1141.5516 -0.510410.0017+1Score > 31 indicates identity
Score > 25 indicates homology		UR.YLQSGYNAAR.K
3733  596.8407 1191.6668 1191.6652 1.401230.33+1Score > 31 indicates identityUR.KWLVEGLGYK.D
5190+1 659.2918 1316.5691 1316.5680 0.790240.18+1Score > 29 indicates identityUR.GQVNHWSSSCR.L
10072  941.4629 1880.9112 1880.9116 -0.190594.6e-006+1Score > 35 indicates identity
Score > 18 indicates homology		UR.LYDTQPSTSLTSQDGIR.Y
11562+1 1039.0319 2076.0492 2076.0488 0.200913.6e-009+1Score > 35 indicates identity
Score > 19 indicates homology		UK.TLLLESGGPSYGVTGGDLNAR.R

+1 subset or intersection (2 subset proteins in total)

ScoreMassSubset of
gi|154698456|gb|EDN98194.1|786081117.1
hypothetical protein SS1G_13051 [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154698456|gb|EDN98194.1|
gi|156035695|ref|XP_001585959.1|7860811
hypothetical protein SS1G_13051 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassSubset of
gi|154698456|gb|EDN98194.1|786081117.1hypothetical protein SS1G_13051 [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154698456|gb|EDN98194.1|
gi|156035695|ref|XP_001585959.1|7860811 hypothetical protein SS1G_13051 [Sclerotinia sclerotiorum 1980 UF-70]

-18

AccessionScoreDescription
1gi|154696912|gb|EDN96650.1|125hypothetical protein SS1G_01576 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
18.1gi|154696912|gb|EDN96650.1|125661778 (4)3 (2)0.16
hypothetical protein SS1G_01576 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154696912|gb|EDN96650.1|
gi|156062920|ref|XP_001597382.1|125661778 (4)3 (2)0.16
hypothetical protein SS1G_01576 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449044|gb|APA06008.1|125634128 (4)3 (2)0.16
hypothetical protein sscle_01g007780 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
18.1gi|154696912|gb|EDN96650.1|125661778 (4)3 (2)0.16hypothetical protein SS1G_01576 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154696912|gb|EDN96650.1|
gi|156062920|ref|XP_001597382.1|125661778 (4)3 (2)0.16hypothetical protein SS1G_01576 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449044|gb|APA06008.1|125634128 (4)3 (2)0.16hypothetical protein sscle_01g007780 [Sclerotinia sclerotiorum 1980 UF-70]

-8 peptide matches (4 non-duplicate, 4 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
2557+1 545.7839 1089.5533 1089.5567 -3.100460.0042+1Score > 34 indicates identityUR.QGAATWTISR.G
2566+2 546.2778 1090.5411 1090.5407 0.360480.0022+1Score > 34 indicates identity
Score > 34 indicates homology		UR.QGAATWTISR.G + Deamidated (NQ)
3138  570.7988 1139.5830 1139.6159 -28.9161.1+2Score > 32 indicates identity
Score > 19 indicates homology		UK.RQAATPSRPR.D + Deamidated (NQ)
8944+1 873.4451 1744.8757 1744.8744 0.730604.5e-006+1Score > 35 indicates identity
Score > 19 indicates homology		UR.ADTFAITGVQDGGIQPR.L

-19

AccessionScoreDescription
Family member distances as a dendrogram1gi|154702253|gb|EDO01992.1|123hypothetical protein SS1G_04468 [Sclerotinia sclerotiorum 1980 UF-70]
2gi|347829827|emb|CCD45524.1|110glycoside hydrolase family 47 protein [Botrytis cinerea T4]
 
Cut threshold

ScoreMassMatchesSequencesemPAI
gi|154702253|gb|EDO01992.1|123580646 (5)4 (4)0.25
hypothetical protein SS1G_04468 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154702253|gb|EDO01992.1|
gi|156057473|ref|XP_001594660.1|123580646 (5)4 (4)0.25
hypothetical protein SS1G_04468 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449920|gb|APA06883.1|123580646 (5)4 (4)0.25
hypothetical protein sscle_02g016530 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347829827|emb|CCD45524.1|110582115 (4)3 (3)0.18
glycoside hydrolase family 47 protein [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
gi|154702253|gb|EDO01992.1|123580646 (5)4 (4)0.25hypothetical protein SS1G_04468 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154702253|gb|EDO01992.1|
gi|156057473|ref|XP_001594660.1|123580646 (5)4 (4)0.25hypothetical protein SS1G_04468 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449920|gb|APA06883.1|123580646 (5)4 (4)0.25hypothetical protein sscle_02g016530 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347829827|emb|CCD45524.1|110582115 (4)3 (3)0.18glycoside hydrolase family 47 protein [Botrytis cinerea T4]

-8 peptide matches (6 non-duplicate, 2 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankU12Peptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankU12Peptide
1147  463.2353 924.4561 924.4552 0.910160.035+1Score > 31 indicates identity
Score > 14 indicates homology		UX K.TYGELSQK.G
2165  525.7319 1049.4492 1049.4488 0.380220.029+1Score > 29 indicates identity
Score > 19 indicates homology		UXXK.MYVYDSTR.F + Oxidation (M)
2278+1 531.2850 1060.5555 1060.5553 0.210380.02+1Score > 34 indicates identityU XR.WIAAADSSIK.H
5404  671.3511 1340.6877 1340.6877 0.0100410.00068+1Score > 33 indicates identity
Score > 22 indicates homology		UX K.WVFNTEAHPLK.V
5405  447.9035 1340.6886 1340.6877 0.65070.23+1Score > 33 indicates identity
Score > 13 indicates homology		UX K.WVFNTEAHPLK.V
5810+1 691.3909 1380.7673 1380.7653 1.460651.8e-006+1Score > 30 indicates identity
Score > 20 indicates homology		UXXR.YVGGLLAGYDLLK.G

-20

AccessionScoreDescription
1gi|154701174|gb|EDO00913.1|117hypothetical protein SS1G_03387 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
20.1gi|154701174|gb|EDO00913.1|117630293 (3)2 (2)0.11
hypothetical protein SS1G_03387 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154701174|gb|EDO00913.1|
gi|156058750|ref|XP_001595298.1|117630293 (3)2 (2)0.11
hypothetical protein SS1G_03387 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095453967|gb|APA10925.1|117697693 (3)2 (2)0.10
hypothetical protein sscle_07g056950 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
20.1gi|154701174|gb|EDO00913.1|117630293 (3)2 (2)0.11hypothetical protein SS1G_03387 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154701174|gb|EDO00913.1|
gi|156058750|ref|XP_001595298.1|117630293 (3)2 (2)0.11hypothetical protein SS1G_03387 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095453967|gb|APA10925.1|117697693 (3)2 (2)0.10hypothetical protein sscle_07g056950 [Sclerotinia sclerotiorum 1980 UF-70]

-3 peptide matches (2 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
794  440.2193 878.4240 878.4246 -0.720300.017+1Score > 33 indicates identity
Score > 25 indicates homology		UK.AEGFNSVR.I
4615+1 633.3358 1264.6571 1264.6564 0.530826.1e-007+1Score > 33 indicates identity
Score > 32 indicates homology		UK.FSALWSQIGTR.M

+1 subset or intersection (1 subset protein in total)

ScoreMassSubset of
gi|347831056|emb|CCD46753.1|307102720.1
glycoside hydrolase family 5 protein [Botrytis cinerea T4]
ScoreMassSubset of
gi|347831056|emb|CCD46753.1|307102720.1glycoside hydrolase family 5 protein [Botrytis cinerea T4]

-21

AccessionScoreDescription
1gi|154696764|gb|EDN96502.1|105hypothetical protein SS1G_01428 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
21.1gi|154696764|gb|EDN96502.1|105456226 (6)2 (2)0.15
hypothetical protein SS1G_01428 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154696764|gb|EDN96502.1|
gi|156062624|ref|XP_001597234.1|105456226 (6)2 (2)0.15
hypothetical protein SS1G_01428 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449159|gb|APA06123.1|105452496 (6)2 (2)0.15
hypothetical protein sscle_01g008930 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
21.1gi|154696764|gb|EDN96502.1|105456226 (6)2 (2)0.15hypothetical protein SS1G_01428 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154696764|gb|EDN96502.1|
gi|156062624|ref|XP_001597234.1|105456226 (6)2 (2)0.15hypothetical protein SS1G_01428 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449159|gb|APA06123.1|105452496 (6)2 (2)0.15hypothetical protein sscle_01g008930 [Sclerotinia sclerotiorum 1980 UF-70]

-6 peptide matches (2 non-duplicate, 4 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
4490+4 628.3484 1254.6822 1254.6820 0.210480.00029+1Score > 32 indicates identity
Score > 25 indicates homology		UK.ASAVVIDPPTSAK.K
7254  771.4236 1540.8326 1540.8290 2.360380.0024+1Score > 32 indicates identity
Score > 25 indicates homology		UK.IFLTPQGTYFQVK.C

+1 subset or intersection (1 subset protein in total)

ScoreMassSubset of
gi|347838629|emb|CCD53201.1|914587921.1
hypothetical protein BofuT4_P122200.1 [Botrytis cinerea T4]
ScoreMassSubset of
gi|347838629|emb|CCD53201.1|914587921.1hypothetical protein BofuT4_P122200.1 [Botrytis cinerea T4]

-22

AccessionScoreDescription
1gi|347832626|emb|CCD48323.1|102glycoside hydrolase family 71 protein [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
22.1gi|347832626|emb|CCD48323.1|102817722 (1)2 (1)0.04
glycoside hydrolase family 71 protein [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
22.1gi|347832626|emb|CCD48323.1|102817722 (1)2 (1)0.04glycoside hydrolase family 71 protein [Botrytis cinerea T4]

-2 peptide matches (2 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
1464  483.7612 965.5078 965.5083 -0.530160.8+1Score > 31 indicates identity
Score > 28 indicates homology		 K.QQFFLQR.G
9019  876.9512 1751.8878 1751.8842 2.0301022.9e-009+1Score > 34 indicates identity
Score > 29 indicates homology		UK.AFASSFAGDQLDIAALR.A

-23

AccessionScoreDescription
1gi|154704206|gb|EDO03945.1|95hypothetical protein SS1G_06426 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
23.1gi|154704206|gb|EDO03945.1|95950786 (4)4 (2)0.07
hypothetical protein SS1G_06426 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154704206|gb|EDO03945.1|
gi|156052521|ref|XP_001592187.1|95950786 (4)4 (2)0.07
hypothetical protein SS1G_06426 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095457549|gb|APA14501.1|95950786 (4)4 (2)0.07
hypothetical protein sscle_13g092710 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
23.1gi|154704206|gb|EDO03945.1|95950786 (4)4 (2)0.07hypothetical protein SS1G_06426 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154704206|gb|EDO03945.1|
gi|156052521|ref|XP_001592187.1|95950786 (4)4 (2)0.07hypothetical protein SS1G_06426 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095457549|gb|APA14501.1|95950786 (4)4 (2)0.07hypothetical protein sscle_13g092710 [Sclerotinia sclerotiorum 1980 UF-70]

-6 peptide matches (4 non-duplicate, 2 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
2424+2 538.7919 1075.5692 1075.5695 -0.340515.5e-005+1Score > 34 indicates identity
Score > 21 indicates homology		UK.TAANAVIAAMK.T + Oxidation (M)
4355  415.2344 1242.6815 1242.6455 28.9032.2+5Score > 33 indicates identity
Score > 19 indicates homology		UK.QAISPNAAEITK.L + Deamidated (NQ)
8059  819.3740 1636.7335 1636.7329 0.360380.00043+1Score > 32 indicates identity
Score > 17 indicates homology		UR.AVGDSSWTSVDSAAER.A
10072  941.4629 1880.9112 1880.9380 -14.3212.8+4Score > 35 indicates identity
Score > 18 indicates homology		UK.NKYTLTPSSSPWGRVR.V + Deamidated (NQ); Dioxidation (W)

-24

AccessionScoreDescription
1gi|1095455126|gb|APA12083.1|91hypothetical protein sscle_08g068530 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
24.1gi|1095455126|gb|APA12083.1|91621689 (3)6 (2)0.11
hypothetical protein sscle_08g068530 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
24.1gi|1095455126|gb|APA12083.1|91621689 (3)6 (2)0.11hypothetical protein sscle_08g068530 [Sclerotinia sclerotiorum 1980 UF-70]

-9 peptide matches (6 non-duplicate, 3 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
36  359.2004 716.3861 716.3817 6.230100.65+1Score > 36 indicates identity
Score > 21 indicates homology		 K.ATAAEVR.S
108+1 372.2185 742.4224 742.4225 -0.130170.45+1Score > 29 indicates identity
Score > 26 indicates homology		 R.TLLGDPK.F
266+1 394.2363 786.4580 786.4599 -2.410645.3e-005+1Score > 34 indicates identityUK.LGDLITR.K
368+1 405.2237 808.4329 808.4555 -28.00132.6+3Score > 30 indicates identity M.PSLHLSR.V
1219  467.7600 933.5055 933.5032 2.430270.027+1Score > 33 indicates identity
Score > 24 indicates homology		UR.GLEHIHTK.Y
3222  575.7861 1149.5577 1149.5700 -10.70025+10Score > 34 indicates identity
Score > 27 indicates homology		 K.ANGTMTLSDLK.N

+1 subset or intersection (1 subset protein in total)

ScoreMassSubset of
gi|347835611|emb|CCD50183.1|276242924.1
similar to gamma-glutamyltransferase 2 (secreted protein) [Botrytis cinerea T4]
ScoreMassSubset of
gi|347835611|emb|CCD50183.1|276242924.1similar to gamma-glutamyltransferase 2 (secreted protein) [Botrytis cinerea T4]

-25

AccessionScoreDescription
1gi|154702326|gb|EDO02065.1|84hypothetical protein SS1G_04541 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
25.1gi|154702326|gb|EDO02065.1|847809211 (5)7 (4)0.18
hypothetical protein SS1G_04541 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154702326|gb|EDO02065.1|
gi|156057619|ref|XP_001594733.1|847809211 (5)7 (4)0.18
hypothetical protein SS1G_04541 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449867|gb|APA06830.1|848032711 (5)7 (4)0.17
hypothetical protein sscle_02g016000 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
25.1gi|154702326|gb|EDO02065.1|847809211 (5)7 (4)0.18hypothetical protein SS1G_04541 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154702326|gb|EDO02065.1|
gi|156057619|ref|XP_001594733.1|847809211 (5)7 (4)0.18hypothetical protein SS1G_04541 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449867|gb|APA06830.1|848032711 (5)7 (4)0.17hypothetical protein sscle_02g016000 [Sclerotinia sclerotiorum 1980 UF-70]

-11 peptide matches (8 non-duplicate, 3 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
47+1 361.6950 721.3753 721.3759 -0.720260.12+1Score > 31 indicates identity
Score > 29 indicates homology		UR.LAFSER.L
1209  466.7616 931.5086 931.5087 -0.0700180.052+1Score > 33 indicates identity
Score > 17 indicates homology		UR.GGQVTTLTR.A
3870  602.8161 1203.6176 1203.6136 3.40021+3Score > 34 indicates identity
Score > 15 indicates homology		UR.DPYVGDIAVAGK.T
4455+2 626.3268 1250.6390 1250.6367 1.820370.00081+1Score > 33 indicates identity
Score > 19 indicates homology		UR.NVLADLADHQR.A
6456  726.8770 1451.7395 1451.7368 1.830450.0003+1Score > 34 indicates identity
Score > 22 indicates homology		UR.STSILNYLNSANR.R
6858  500.6033 1498.7881 1498.7892 -0.75020.75+1Score > 33 indicates identity
Score > 13 indicates homology		UK.TLFLSHNKPEASR.N
6859  750.4016 1498.7885 1498.7892 -0.440290.0027+1Score > 33 indicates identity
Score > 16 indicates homology		UK.TLFLSHNKPEASR.N
7513  783.8747 1565.7348 1565.7070 17.81210+5Score > 34 indicates identity
Score > 25 indicates homology		UK.SQGQSADASRWLAR.A + 2 Deamidated (NQ); Dioxidation (W)

-26

AccessionScoreDescription
1gi|154698322|gb|EDN98060.1|83hypothetical protein SS1G_12917 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
26.1gi|154698322|gb|EDN98060.1|83430695 (2)2 (2)0.16
hypothetical protein SS1G_12917 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154698322|gb|EDN98060.1|
gi|156036456|ref|XP_001586339.1|83430695 (2)2 (2)0.16
hypothetical protein SS1G_12917 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449456|gb|APA06419.1|83430695 (2)2 (2)0.16
hypothetical protein sscle_02g011890 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
26.1gi|154698322|gb|EDN98060.1|83430695 (2)2 (2)0.16hypothetical protein SS1G_12917 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154698322|gb|EDN98060.1|
gi|156036456|ref|XP_001586339.1|83430695 (2)2 (2)0.16hypothetical protein SS1G_12917 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449456|gb|APA06419.1|83430695 (2)2 (2)0.16hypothetical protein sscle_02g011890 [Sclerotinia sclerotiorum 1980 UF-70]

-5 peptide matches (4 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
4845+1 644.8442 1287.6738 1287.6724 1.090560.00037+1Score > 34 indicates identity
Score > 34 indicates homology		UK.SWIQPFAGQVR.I
18512  1035.1588 3102.4546 3102.4492 1.750270.43+1Score > 35 indicates identityUK.SVLGFNEPDLTYEQSSNMLPEVAAQGYK.S + Oxidation (M)
18514  1552.2425 3102.4705 3102.4492 6.890630.00011+1Score > 36 indicates identityUK.SVLGFNEPDLTYEQSSNMLPEVAAQGYK.S + Oxidation (M)
18516  1552.7203 3103.4261 3103.4332 -2.270320.11+1Score > 35 indicates identityUK.SVLGFNEPDLTYEQSSNMLPEVAAQGYK.S + Deamidated (NQ); Oxidation (M)

-27

AccessionScoreDescription
1gi|347840672|emb|CCD55244.1|79similar to extracellular dihydrogeodin oxidase/laccase [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
27.1gi|347840672|emb|CCD55244.1|796506611 (7)4 (1)0.16
similar to extracellular dihydrogeodin oxidase/laccase [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
27.1gi|347840672|emb|CCD55244.1|796506611 (7)4 (1)0.16similar to extracellular dihydrogeodin oxidase/laccase [Botrytis cinerea T4]

-11 peptide matches (6 non-duplicate, 5 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
3354+1 581.3000 1160.5854 1160.5859 -0.440220.038+1Score > 34 indicates identity
Score > 20 indicates homology		UR.LINAGTEGMQK.F
3547+3 589.2977 1176.5809 1176.5809 0.0440350.0082+1Score > 34 indicates identity
Score > 26 indicates homology		UR.LINAGTEGMQK.F + Oxidation (M)
3554+1 589.7905 1177.5665 1177.5649 1.400350.0016+1Score > 34 indicates identity
Score > 20 indicates homology		UR.LINAGTEGMQK.F + Deamidated (NQ); Oxidation (M)
5599  680.3733 1358.7320 1358.7405 -6.26025.1+10Score > 34 indicates identity
Score > 22 indicates homology		UR.VLVSSDSNLIQGK.G
7301  773.8876 1545.7607 1545.7821 -13.8121.2+4Score > 34 indicates identity
Score > 16 indicates homology		UR.STIAGCSLAKNPEAK.A
20592  878.2086 3508.8051 3508.7249 22.9031.5+4Score > 34 indicates identity
Score > 17 indicates homology		UR.DVILVNDVFPGPLIEANWGDTIEVTVHNEIR.G + 3 Deamidated (NQ); Dioxidation (W)

-28

AccessionScoreDescription
1gi|154691589|gb|EDN91327.1|78hypothetical protein SS1G_00730 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
28.1gi|154691589|gb|EDN91327.1|786663810 (6)4 (2)0.10
hypothetical protein SS1G_00730 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154691589|gb|EDN91327.1|
gi|156065439|ref|XP_001598641.1|786663810 (6)4 (2)0.10
hypothetical protein SS1G_00730 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095450750|gb|APA07712.1|786663810 (6)4 (2)0.10
hypothetical protein sscle_03g024820 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
28.1gi|154691589|gb|EDN91327.1|786663810 (6)4 (2)0.10hypothetical protein SS1G_00730 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154691589|gb|EDN91327.1|
gi|156065439|ref|XP_001598641.1|786663810 (6)4 (2)0.10hypothetical protein SS1G_00730 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095450750|gb|APA07712.1|786663810 (6)4 (2)0.10hypothetical protein sscle_03g024820 [Sclerotinia sclerotiorum 1980 UF-70]

-10 peptide matches (4 non-duplicate, 6 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
334  400.7528 799.4910 799.4916 -0.730430.0034+1Score > 31 indicates identityUR.VLGVSGLR.V
471  415.2429 828.4712 828.4705 0.800190.2+1Score > 32 indicates identity
Score > 25 indicates homology		UR.VNAPTISK.L
1522  487.2313 972.4481 972.4487 -0.66071+1Score > 29 indicates identity
Score > 19 indicates homology		UR.NFMVYQR.G + Oxidation (M)
2224+6 528.2540 1054.4935 1054.4931 0.400420.00035+1Score > 31 indicates identity
Score > 20 indicates homology		UR.ESSETSFLR.A

+1 subset or intersection (1 subset protein in total)

ScoreMassSubset of
gi|347828260|emb|CCD43957.1|646706828.1
similar to GMC oxidoreductase [Botrytis cinerea T4]
ScoreMassSubset of
gi|347828260|emb|CCD43957.1|646706828.1similar to GMC oxidoreductase [Botrytis cinerea T4]

-29

AccessionScoreDescription
1gi|154704145|gb|EDO03884.1|72hypothetical protein SS1G_06365 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
29.1gi|154704145|gb|EDO03884.1|72632517 (2)3 (2)0.11
hypothetical protein SS1G_06365 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154704145|gb|EDO03884.1|
gi|156052399|ref|XP_001592126.1|72632517 (2)3 (2)0.11
hypothetical protein SS1G_06365 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095457515|gb|APA14467.1|72626007 (2)3 (2)0.11
hypothetical protein sscle_13g092370 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
29.1gi|154704145|gb|EDO03884.1|72632517 (2)3 (2)0.11hypothetical protein SS1G_06365 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154704145|gb|EDO03884.1|
gi|156052399|ref|XP_001592126.1|72632517 (2)3 (2)0.11hypothetical protein SS1G_06365 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095457515|gb|APA14467.1|72626007 (2)3 (2)0.11hypothetical protein sscle_13g092370 [Sclerotinia sclerotiorum 1980 UF-70]

-7 peptide matches (3 non-duplicate, 4 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
983  451.6951 901.3756 901.3752 0.400400.00073+1Score > 24 indicates identity
Score > 21 indicates homology		UK.SGSYWMR.S + Oxidation (M)
1852+4 508.2460 1014.4775 1014.4771 0.440570.00011+1Score > 30 indicates identityUR.SYDFTVQR.G
3056  566.8016 1131.5887 1131.5771 10.2061.6+4Score > 34 indicates identity
Score > 21 indicates homology		UR.LINAGTEGTQK.F + Deamidated (NQ)

-30

AccessionScoreDescription
1gi|154697112|gb|EDN96850.1|71hypothetical protein SS1G_01776 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
30.1gi|154697112|gb|EDN96850.1|71493113 (3)2 (2)0.14
hypothetical protein SS1G_01776 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154697112|gb|EDN96850.1|
gi|156063320|ref|XP_001597582.1|71493113 (3)2 (2)0.14
hypothetical protein SS1G_01776 [Sclerotinia sclerotiorum 1980 UF-70]
gi|225200260|gb|ACN82436.1|71550553 (3)2 (2)0.12
alpha-amylase [Sclerotinia sclerotiorum]
gi|1095448879|gb|APA05843.1|71550553 (3)2 (2)0.12
hypothetical protein sscle_01g006130 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
30.1gi|154697112|gb|EDN96850.1|71493113 (3)2 (2)0.14hypothetical protein SS1G_01776 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154697112|gb|EDN96850.1|
gi|156063320|ref|XP_001597582.1|71493113 (3)2 (2)0.14hypothetical protein SS1G_01776 [Sclerotinia sclerotiorum 1980 UF-70]
gi|225200260|gb|ACN82436.1|71550553 (3)2 (2)0.12alpha-amylase [Sclerotinia sclerotiorum]
gi|1095448879|gb|APA05843.1|71550553 (3)2 (2)0.12hypothetical protein sscle_01g006130 [Sclerotinia sclerotiorum 1980 UF-70]

-3 peptide matches (2 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
2142  524.3008 1046.5870 1046.5873 -0.250370.01+1Score > 32 indicates identity
Score > 30 indicates homology		UR.FIASVNQIR.N
5102+1 655.3424 1308.6701 1308.6674 2.120470.00027+1Score > 33 indicates identity
Score > 23 indicates homology		UR.SQSIYQVITDR.F

-31

AccessionScoreDescription
1gi|347831150|emb|CCD46847.1|67hypothetical protein BofuT4_P115530.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
31.1gi|347831150|emb|CCD46847.1|67413371 (1)1 (1)0.08
hypothetical protein BofuT4_P115530.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
31.1gi|347831150|emb|CCD46847.1|67413371 (1)1 (1)0.08hypothetical protein BofuT4_P115530.1 [Botrytis cinerea T4]

-1 peptide matches (1 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
9839  926.8968 1851.7790 1851.7768 1.210679.9e-006+1Score > 30 indicates identityUK.GGFNMQSTTSIDCSGFK.S + Oxidation (M)

-32

AccessionScoreDescription
1gi|154698335|gb|EDN98073.1|63hypothetical protein SS1G_12930 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
32.1gi|154698335|gb|EDN98073.1|63319963 (2)2 (2)0.22
hypothetical protein SS1G_12930 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154698335|gb|EDN98073.1|
gi|156036482|ref|XP_001586352.1|63319963 (2)2 (2)0.22
hypothetical protein SS1G_12930 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449447|gb|APA06410.1|63319963 (2)2 (2)0.22
hypothetical protein sscle_02g011800 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
32.1gi|154698335|gb|EDN98073.1|63319963 (2)2 (2)0.22hypothetical protein SS1G_12930 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154698335|gb|EDN98073.1|
gi|156036482|ref|XP_001586352.1|63319963 (2)2 (2)0.22hypothetical protein SS1G_12930 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449447|gb|APA06410.1|63319963 (2)2 (2)0.22hypothetical protein sscle_02g011800 [Sclerotinia sclerotiorum 1980 UF-70]

-3 peptide matches (2 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
567  422.2554 842.4963 842.4974 -1.270570.00017+1Score > 32 indicates identityUK.QALLAATR.T
4764+1 641.2784 1280.5423 1280.5422 0.120350.0066+1Score > 29 indicates identity
Score > 26 indicates homology		UK.TQADWENDFR.M

-33

AccessionScoreDescription
1gi|347841076|emb|CCD55648.1|61similar to cellobiose dehydrogenase [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
33.1gi|347841076|emb|CCD55648.1|61610153 (2)1 (1)0.05
similar to cellobiose dehydrogenase [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
33.1gi|347841076|emb|CCD55648.1|61610153 (2)1 (1)0.05similar to cellobiose dehydrogenase [Botrytis cinerea T4]

-3 peptide matches (1 non-duplicate, 2 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
6762+2 745.9007 1489.7868 1489.7889 -1.370496.2e-005+1Score > 34 indicates identity
Score > 20 indicates homology		UR.GGPVTTYLQSALQR.S

-34

AccessionScoreDescription
1gi|154700524|gb|EDO00263.1|60hypothetical protein SS1G_14133 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
34.1gi|154700524|gb|EDO00263.1|60329066 (3)3 (1)0.10
hypothetical protein SS1G_14133 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154700524|gb|EDO00263.1|
gi|156031050|ref|XP_001584850.1|60329066 (3)3 (1)0.10
hypothetical protein SS1G_14133 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095455123|gb|APA12080.1|60329066 (3)3 (1)0.10
hypothetical protein sscle_08g068500 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347832563|emb|CCD48260.1|60666173 (3)1 (1)0.05
hypothetical protein BofuT4_P106440.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
34.1gi|154700524|gb|EDO00263.1|60329066 (3)3 (1)0.10hypothetical protein SS1G_14133 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154700524|gb|EDO00263.1|
gi|156031050|ref|XP_001584850.1|60329066 (3)3 (1)0.10hypothetical protein SS1G_14133 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095455123|gb|APA12080.1|60329066 (3)3 (1)0.10hypothetical protein sscle_08g068500 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347832563|emb|CCD48260.1|60666173 (3)1 (1)0.05hypothetical protein BofuT4_P106440.1 [Botrytis cinerea T4]

-6 peptide matches (3 non-duplicate, 3 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
714+2 433.2555 864.4965 864.4957 0.970420.0022+1Score > 28 indicates identity
Score > 28 indicates homology		UK.LDLTYIK.Y
6288+1 717.8968 1433.7790 1433.7766 1.71091+1Score > 32 indicates identity
Score > 22 indicates homology		UK.SSNSVLPDLVYIK.T
22796  808.3901 4036.9143 4036.9443 -7.42121+6Score > 35 indicates identity
Score > 14 indicates homology		UR.ILDTGTTFVEEHNGWWQLIDATGDGRPDLAYIKNK.N + 2 Dioxidation (W)

-35

AccessionScoreDescription
1gi|347836311|emb|CCD50883.1|56glycoside hydrolase family 3 protein [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
35.1gi|347836311|emb|CCD50883.1|56940467 (3)5 (3)0.11
glycoside hydrolase family 3 protein [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
35.1gi|347836311|emb|CCD50883.1|56940467 (3)5 (3)0.11glycoside hydrolase family 3 protein [Botrytis cinerea T4]

-7 peptide matches (6 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
588  424.7183 847.4220 847.4222 -0.25061.1+2Score > 34 indicates identity
Score > 19 indicates homology		UR.LNDMVTR.I
698  432.7164 863.4183 863.4171 1.400360.0029+1Score > 33 indicates identity
Score > 23 indicates homology		UR.LNDMVTR.I + Oxidation (M)
1042+1 456.2694 910.5243 910.5236 0.79042.3+6Score > 28 indicates identity
Score > 21 indicates homology		UK.AITSVPPAR.A
1520  486.7953 971.5760 971.5764 -0.370390.0048+1Score > 32 indicates identity
Score > 28 indicates homology		UK.QVVSLAVTR.K
1676  495.7459 989.4772 989.4778 -0.570310.013+1Score > 33 indicates identity
Score > 24 indicates homology		UK.ALSSNIDDR.T
24324  1652.4207 4954.2401 4954.3469 -21.6131.1+7Score > 34 indicates identity
Score > 16 indicates homology		UR.TLHEFYMWPFAEGIKAGVGAVMTSYNDVNGSAASQNSYLINNLIK.D + 2 Deamidated (NQ); 2 Oxidation (M)

+2 subsets and intersections (7 subset proteins in total)

ScoreMassSubset of
gi|1095453406|gb|APA10365.1|439419335.1
hypothetical protein sscle_06g051350 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|1095453406|gb|APA10365.1|
gi|154704940|gb|EDO04679.1|4394193
hypothetical protein SS1G_07162 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156051510|ref|XP_001591716.1|4394193
hypothetical protein SS1G_07162 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095454631|gb|APA11588.1|3610506335.1
hypothetical protein sscle_08g063580 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|1095454631|gb|APA11588.1|
gi|154702815|gb|EDO02554.1|36105063
hypothetical protein SS1G_05030 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156055358|ref|XP_001593603.1|36105063
hypothetical protein SS1G_05030 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347827528|emb|CCD43225.1|36105076
glycoside hydrolase family 3 protein [Botrytis cinerea T4]
ScoreMassSubset of
gi|1095453406|gb|APA10365.1|439419335.1hypothetical protein sscle_06g051350 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|1095453406|gb|APA10365.1|
gi|154704940|gb|EDO04679.1|4394193 hypothetical protein SS1G_07162 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156051510|ref|XP_001591716.1|4394193 hypothetical protein SS1G_07162 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095454631|gb|APA11588.1|3610506335.1hypothetical protein sscle_08g063580 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|1095454631|gb|APA11588.1|
gi|154702815|gb|EDO02554.1|36105063 hypothetical protein SS1G_05030 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156055358|ref|XP_001593603.1|36105063 hypothetical protein SS1G_05030 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347827528|emb|CCD43225.1|36105076 glycoside hydrolase family 3 protein [Botrytis cinerea T4]

-36

AccessionScoreDescription
1gi|154696502|gb|EDN96240.1|54predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
36.1gi|154696502|gb|EDN96240.1|541731110 (7)2 (1)0.20
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154696502|gb|EDN96240.1|
gi|156062100|ref|XP_001596972.1|541731110 (7)2 (1)0.20
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449358|gb|APA06322.1|542747510 (7)2 (1)0.12
hypothetical protein sscle_01g010920 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
36.1gi|154696502|gb|EDN96240.1|541731110 (7)2 (1)0.20predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154696502|gb|EDN96240.1|
gi|156062100|ref|XP_001596972.1|541731110 (7)2 (1)0.20predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449358|gb|APA06322.1|542747510 (7)2 (1)0.12hypothetical protein sscle_01g010920 [Sclerotinia sclerotiorum 1980 UF-70]

-10 peptide matches (2 non-duplicate, 8 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
228+8 390.2415 778.4685 778.4701 -2.080240.0099+1Score > 24 indicates identity
Score > 16 indicates homology		UM.PLPLSPR.S
7094  765.3759 1528.7373 1528.7310 4.10001.1+3Score > 34 indicates identity
Score > 13 indicates homology		 R.TSYYDLHYQIAR.T

-37

AccessionScoreDescription
1gi|154691568|gb|EDN91306.1|53hypothetical protein SS1G_00709 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
37.1gi|154691568|gb|EDN91306.1|53313981 (1)1 (1)0.11
hypothetical protein SS1G_00709 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154691568|gb|EDN91306.1|
gi|156065397|ref|XP_001598620.1|53313981 (1)1 (1)0.11
hypothetical protein SS1G_00709 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347442007|emb|CCD34928.1|53355511 (1)1 (1)0.09
similar to transaldolase [Botrytis cinerea T4]
gi|1095450763|gb|APA07725.1|53355061 (1)1 (1)0.09
hypothetical protein sscle_03g024950 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
37.1gi|154691568|gb|EDN91306.1|53313981 (1)1 (1)0.11hypothetical protein SS1G_00709 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154691568|gb|EDN91306.1|
gi|156065397|ref|XP_001598620.1|53313981 (1)1 (1)0.11hypothetical protein SS1G_00709 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347442007|emb|CCD34928.1|53355511 (1)1 (1)0.09similar to transaldolase [Botrytis cinerea T4]
gi|1095450763|gb|APA07725.1|53355061 (1)1 (1)0.09hypothetical protein sscle_03g024950 [Sclerotinia sclerotiorum 1980 UF-70]

-1 peptide matches (1 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
5014  651.8437 1301.6728 1301.6728 0.0410530.00081+1Score > 34 indicates identityUK.IASTWEGIQAAR.I

-38

AccessionScoreDescription
1gi|347838742|emb|CCD53314.1|52hypothetical protein BofuT4_P123330.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
38.1gi|347838742|emb|CCD53314.1|52272957 (5)2 (1)0.12
hypothetical protein BofuT4_P123330.1 [Botrytis cinerea T4]
+4 samesets of gi|347838742|emb|CCD53314.1|
gi|154698228|gb|EDN97966.1|52308806 (5)1 (1)0.11
hypothetical protein SS1G_12822 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156036268|ref|XP_001586245.1|52308806 (5)1 (1)0.11
hypothetical protein SS1G_12822 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347826560|emb|CCD42257.1|52307486 (5)1 (1)0.11
hypothetical protein BofuT4_P013850.1 [Botrytis cinerea T4]
gi|1095449525|gb|APA06488.1|52308806 (5)1 (1)0.11
hypothetical protein sscle_02g012580 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
38.1gi|347838742|emb|CCD53314.1|52272957 (5)2 (1)0.12hypothetical protein BofuT4_P123330.1 [Botrytis cinerea T4]
+4 samesets of gi|347838742|emb|CCD53314.1|
gi|154698228|gb|EDN97966.1|52308806 (5)1 (1)0.11hypothetical protein SS1G_12822 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156036268|ref|XP_001586245.1|52308806 (5)1 (1)0.11hypothetical protein SS1G_12822 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347826560|emb|CCD42257.1|52307486 (5)1 (1)0.11hypothetical protein BofuT4_P013850.1 [Botrytis cinerea T4]
gi|1095449525|gb|APA06488.1|52308806 (5)1 (1)0.11hypothetical protein sscle_02g012580 [Sclerotinia sclerotiorum 1980 UF-70]

-7 peptide matches (2 non-duplicate, 5 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
469+5 415.2425 828.4704 828.4705 -0.150390.011+1Score > 32 indicates identityUK.IIELEGR.G
5837  693.3595 1384.7044 1384.7351 -22.1092.5+3Score > 33 indicates identity
Score > 25 indicates homology		UK.WTITIPSNPTVR.F + Deamidated (NQ)

+1 subset or intersection (4 subset proteins in total)

ScoreMassSubset of
gi|1095458230|gb|APA15181.1|4711138538.1
hypothetical protein sscle_14g099510 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|1095458230|gb|APA15181.1|
gi|154693184|gb|EDN92922.1|47113387
hypothetical protein SS1G_08787 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156048112|ref|XP_001590023.1|47113387
hypothetical protein SS1G_08787 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347832999|emb|CCD48696.1|47111904
hypothetical protein BofuT4_P033380.1 [Botrytis cinerea T4]
ScoreMassSubset of
gi|1095458230|gb|APA15181.1|4711138538.1hypothetical protein sscle_14g099510 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|1095458230|gb|APA15181.1|
gi|154693184|gb|EDN92922.1|47113387 hypothetical protein SS1G_08787 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156048112|ref|XP_001590023.1|47113387 hypothetical protein SS1G_08787 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347832999|emb|CCD48696.1|47111904 hypothetical protein BofuT4_P033380.1 [Botrytis cinerea T4]

-39

AccessionScoreDescription
1gi|154698875|gb|EDN98613.1|48hypothetical protein SS1G_13472 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
39.1gi|154698875|gb|EDN98613.1|48605722 (1)2 (1)0.05
hypothetical protein SS1G_13472 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154698875|gb|EDN98613.1|
gi|156034338|ref|XP_001585588.1|48605722 (1)2 (1)0.05
hypothetical protein SS1G_13472 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095458571|gb|APA15521.1|48605722 (1)2 (1)0.05
hypothetical protein sscle_15g102910 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
39.1gi|154698875|gb|EDN98613.1|48605722 (1)2 (1)0.05hypothetical protein SS1G_13472 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154698875|gb|EDN98613.1|
gi|156034338|ref|XP_001585588.1|48605722 (1)2 (1)0.05hypothetical protein SS1G_13472 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095458571|gb|APA15521.1|48605722 (1)2 (1)0.05hypothetical protein sscle_15g102910 [Sclerotinia sclerotiorum 1980 UF-70]

-2 peptide matches (2 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
1149  463.2674 924.5203 924.5392 -20.5122.3+7Score > 29 indicates identity
Score > 18 indicates homology		UK.KLSAELHK.R
2765  554.8043 1107.5941 1107.5924 1.520480.00064+1Score > 32 indicates identity
Score > 29 indicates homology		UR.SIYQIITDR.Y

-40

AccessionScoreDescription
1gi|347827005|emb|CCD42702.1|47hypothetical protein BofuT4_P073140.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
40.1gi|347827005|emb|CCD42702.1|47665872 (2)2 (2)0.10
hypothetical protein BofuT4_P073140.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
40.1gi|347827005|emb|CCD42702.1|47665872 (2)2 (2)0.10hypothetical protein BofuT4_P073140.1 [Botrytis cinerea T4]

-2 peptide matches (2 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
1516  486.7683 971.5219 971.5222 -0.290390.0023+1Score > 32 indicates identity
Score > 25 indicates homology		UR.MVVGNPALR.T + Oxidation (M)
1961  513.7776 1025.5406 1025.5407 -0.0360320.0062+1Score > 30 indicates identity
Score > 22 indicates homology		UK.ITAFQPGHR.M

-41

AccessionScoreDescription
1gi|507414638|emb|CCD56877.2|46carbohydrate-Binding Module family 20 protein [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
41.1gi|507414638|emb|CCD56877.2|46430953 (1)2 (1)0.08
carbohydrate-Binding Module family 20 protein [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
41.1gi|507414638|emb|CCD56877.2|46430953 (1)2 (1)0.08carbohydrate-Binding Module family 20 protein [Botrytis cinerea T4]

-3 peptide matches (2 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
1580+1 491.2144 980.4142 980.4134 0.840170.21+1Score > 29 indicates identity
Score > 23 indicates homology		 R.SGPCGYNAR.V
3876  603.2950 1204.5755 1204.5758 -0.220460.00092+1Score > 34 indicates identity
Score > 28 indicates homology		UR.ICQDQSIVDK.L

-42

AccessionScoreDescription
1gi|154702896|gb|EDO02635.1|44laccase precursor [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
42.1gi|154702896|gb|EDO02635.1|44661339 (3)4 (3)0.16
laccase precursor [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154702896|gb|EDO02635.1|
gi|156055520|ref|XP_001593684.1|44661339 (3)4 (3)0.16
laccase precursor [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095454699|gb|APA11656.1|44660059 (3)4 (3)0.16
hypothetical protein sscle_08g064260 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
42.1gi|154702896|gb|EDO02635.1|44661339 (3)4 (3)0.16laccase precursor [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154702896|gb|EDO02635.1|
gi|156055520|ref|XP_001593684.1|44661339 (3)4 (3)0.16laccase precursor [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095454699|gb|APA11656.1|44660059 (3)4 (3)0.16hypothetical protein sscle_08g064260 [Sclerotinia sclerotiorum 1980 UF-70]

-9 peptide matches (6 non-duplicate, 3 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
1869  508.7556 1015.4965 1015.4975 -0.890420.0013+1Score > 32 indicates identity
Score > 25 indicates homology		UR.YYDLTVSR.S
2414+1 538.2913 1074.5680 1074.5669 0.970210.14+1Score > 34 indicates identity
Score > 25 indicates homology		UR.LINAGSSGTQK.F
2419+1 538.7833 1075.5520 1075.5509 0.960110.8+3Score > 34 indicates identity
Score > 22 indicates homology		UR.LINAGSSGTQK.F + Deamidated (NQ)
2760+1 554.7416 1107.4687 1107.4689 -0.140170.2+1Score > 30 indicates identity
Score > 22 indicates homology		UR.SDLDVPCMR.L + Oxidation (M)
10332  954.9949 1907.9752 1907.9741 0.560360.037+1Score > 35 indicates identityUK.VPNGPVFPNVDNNLINGK.G + Deamidated (NQ)
10343  955.4890 1908.9633 1908.9581 2.73071+1Score > 35 indicates identity
Score > 19 indicates homology		UK.VPNGPVFPNVDNNLINGK.G + 2 Deamidated (NQ)

+1 subset or intersection (1 subset protein in total)

ScoreMassSubset of
gi|347840621|emb|CCD55193.1|426644642.1
similar to extracellular dihydrogeodin oxidase/laccase [Botrytis cinerea T4]
ScoreMassSubset of
gi|347840621|emb|CCD55193.1|426644642.1similar to extracellular dihydrogeodin oxidase/laccase [Botrytis cinerea T4]

-43

AccessionScoreDescription
1gi|347827354|emb|CCD43051.1|43similar to phosphatidylserine decarboxylase [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
43.1gi|347827354|emb|CCD43051.1|43465908 (1)6 (1)0.07
similar to phosphatidylserine decarboxylase [Botrytis cinerea T4]
+3 samesets of gi|347827354|emb|CCD43051.1|
gi|154702348|gb|EDO02087.1|43474793 (1)2 (1)0.07
phosphatidylserine decarboxylase [Sclerotinia sclerotiorum 1980 UF-70]
gi|156057663|ref|XP_001594755.1|43474793 (1)2 (1)0.07
phosphatidylserine decarboxylase [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449848|gb|APA06811.1|43474793 (1)2 (1)0.07
hypothetical protein sscle_02g015810 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
43.1gi|347827354|emb|CCD43051.1|43465908 (1)6 (1)0.07similar to phosphatidylserine decarboxylase [Botrytis cinerea T4]
+3 samesets of gi|347827354|emb|CCD43051.1|
gi|154702348|gb|EDO02087.1|43474793 (1)2 (1)0.07phosphatidylserine decarboxylase [Sclerotinia sclerotiorum 1980 UF-70]
gi|156057663|ref|XP_001594755.1|43474793 (1)2 (1)0.07phosphatidylserine decarboxylase [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449848|gb|APA06811.1|43474793 (1)2 (1)0.07hypothetical protein sscle_02g015810 [Sclerotinia sclerotiorum 1980 UF-70]

-8 peptide matches (7 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
2563  546.2730 1090.5315 1090.5295 1.84151.5+4Score > 34 indicates identity
Score > 19 indicates homology		UK.EKVPNFDNK.T + Deamidated (NQ)
3051  566.7774 1131.5402 1131.5408 -0.480430.00049+1Score > 33 indicates identity
Score > 23 indicates homology		UR.EVDDLDTAVR.N
3444+1 584.8052 1167.5958 1167.6149 -16.3121+1Score > 32 indicates identity
Score > 14 indicates homology		UK.KAGGHNFLAPR.R + Deamidated (NQ)
5617  682.3353 1362.6560 1362.6456 7.661131.2+2Score > 34 indicates identity
Score > 26 indicates homology		UR.VFEAEDPKNWK.T + Deamidated (NQ)
9025  585.0006 1751.9800 1751.9570 13.10101+1Score > 30 indicates identity
Score > 22 indicates homology		UK.NVNKPLTPLSDWLVR.F + Deamidated (NQ)
22783  808.1889 4035.9081 4035.8591 12.1221.1+7Score > 35 indicates identity
Score > 15 indicates homology		UK.EKVPNFDNKTTYGELFQEGIWTHSFLNTFDYHR.Q + 3 Deamidated (NQ)
22794  808.3888 4036.9076 4036.8432 16.0240.72+1Score > 35 indicates identity
Score > 16 indicates homology		UK.EKVPNFDNKTTYGELFQEGIWTHSFLNTFDYHR.Q + 4 Deamidated (NQ)

-44

AccessionScoreDescription
1gi|1095454060|gb|APA11018.1|42hypothetical protein sscle_07g057880 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
44.1gi|1095454060|gb|APA11018.1|42423632 (1)1 (1)0.08
hypothetical protein sscle_07g057880 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
44.1gi|1095454060|gb|APA11018.1|42423632 (1)1 (1)0.08hypothetical protein sscle_07g057880 [Sclerotinia sclerotiorum 1980 UF-70]

-2 peptide matches (1 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
2584+1 547.2519 1092.4893 1092.4910 -1.500420.00054+1Score > 32 indicates identity
Score > 22 indicates homology		UR.EYAPMDVPR.H + Oxidation (M)

-45

AccessionScoreDescription
1gi|1095457170|gb|APA14123.1|41hypothetical protein sscle_12g088930 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
45.1gi|1095457170|gb|APA14123.1|41248664 (1)3 (1)0.13
hypothetical protein sscle_12g088930 [Sclerotinia sclerotiorum 1980 UF-70]
+11 samesets of gi|1095457170|gb|APA14123.1|
gi|154695422|gb|EDN95160.1|41179733 (1)2 (1)0.19
ubiquitin fusion protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|154697207|gb|EDN96945.1|41148423 (1)2 (1)0.23
ubiquitin fusion protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|156042476|ref|XP_001587795.1|41179733 (1)2 (1)0.19
ubiquitin-40S ribosomal protein S31 fusion protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|156063510|ref|XP_001597677.1|41148423 (1)2 (1)0.23
ubiquitin-60S ribosomal protein L40 fusion protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|347841176|emb|CCD55748.1|41179733 (1)2 (1)0.19
similar to ubiquitin/40S ribosomal protein S27a [Botrytis cinerea T4]
gi|154691033|gb|EDN90771.1|41342424 (1)3 (1)0.10
polyubiquitin [Sclerotinia sclerotiorum 1980 UF-70]
gi|156064327|ref|XP_001598085.1|41342424 (1)3 (1)0.10
polyubiquitin [Sclerotinia sclerotiorum 1980 UF-70]
gi|347836850|emb|CCD51422.1|41342164 (1)3 (1)0.10
similar to polyubiquitin protein [Botrytis cinerea T4]
gi|1095451191|gb|APA08153.1|41342424 (1)3 (1)0.10
hypothetical protein sscle_03g029230 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347830393|emb|CCD46090.1|41190332 (1)1 (1)0.18
hypothetical protein BofuT4_P116400.1 [Botrytis cinerea T4]
gi|1095448800|gb|APA05764.1|41153082 (1)1 (1)0.22
hypothetical protein sscle_01g005340 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
45.1gi|1095457170|gb|APA14123.1|41248664 (1)3 (1)0.13hypothetical protein sscle_12g088930 [Sclerotinia sclerotiorum 1980 UF-70]
+11 samesets of gi|1095457170|gb|APA14123.1|
gi|154695422|gb|EDN95160.1|41179733 (1)2 (1)0.19ubiquitin fusion protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|154697207|gb|EDN96945.1|41148423 (1)2 (1)0.23ubiquitin fusion protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|156042476|ref|XP_001587795.1|41179733 (1)2 (1)0.19ubiquitin-40S ribosomal protein S31 fusion protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|156063510|ref|XP_001597677.1|41148423 (1)2 (1)0.23ubiquitin-60S ribosomal protein L40 fusion protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|347841176|emb|CCD55748.1|41179733 (1)2 (1)0.19similar to ubiquitin/40S ribosomal protein S27a [Botrytis cinerea T4]
gi|154691033|gb|EDN90771.1|41342424 (1)3 (1)0.10polyubiquitin [Sclerotinia sclerotiorum 1980 UF-70]
gi|156064327|ref|XP_001598085.1|41342424 (1)3 (1)0.10polyubiquitin [Sclerotinia sclerotiorum 1980 UF-70]
gi|347836850|emb|CCD51422.1|41342164 (1)3 (1)0.10similar to polyubiquitin protein [Botrytis cinerea T4]
gi|1095451191|gb|APA08153.1|41342424 (1)3 (1)0.10hypothetical protein sscle_03g029230 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347830393|emb|CCD46090.1|41190332 (1)1 (1)0.18hypothetical protein BofuT4_P116400.1 [Botrytis cinerea T4]
gi|1095448800|gb|APA05764.1|41153082 (1)1 (1)0.22hypothetical protein sscle_01g005340 [Sclerotinia sclerotiorum 1980 UF-70]

-4 peptide matches (3 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
2325+1 534.3144 1066.6143 1066.6135 0.810410.0019+1Score > 28 indicates identity
Score > 26 indicates homology		UK.ESTLHLVLR.L
2675  550.3094 1098.6042 1098.5822 20.1052.4+3Score > 31 indicates identity
Score > 22 indicates homology		UM.VSPNLLNWR.V + Deamidated (NQ)
22588  796.6243 3978.0850 3978.1374 -13.2230.98+1Score > 32 indicates identity
Score > 15 indicates homology		UK.TIQIIVQAVMQIFVKTLTGKTITLEVESSDTIDNVK.A + 3 Deamidated (NQ)

-46

AccessionScoreDescription
1gi|347838722|emb|CCD53294.1|40hypothetical protein BofuT4_P123130.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
46.1gi|347838722|emb|CCD53294.1|40216742 (2)1 (1)0.16
hypothetical protein BofuT4_P123130.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
46.1gi|347838722|emb|CCD53294.1|40216742 (2)1 (1)0.16hypothetical protein BofuT4_P123130.1 [Botrytis cinerea T4]

-2 peptide matches (1 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
1612+1 492.7467 983.4788 983.4753 3.640350.02+1Score > 31 indicates identityUK.FWDFELK.Q

-47

AccessionScoreDescription
1gi|154693234|gb|EDN92972.1|40hypothetical protein SS1G_08837 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
47.1gi|154693234|gb|EDN92972.1|40448961 (1)1 (1)0.07
hypothetical protein SS1G_08837 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154693234|gb|EDN92972.1|
gi|156048212|ref|XP_001590073.1|40448961 (1)1 (1)0.07
hypothetical protein SS1G_08837 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095458271|gb|APA15222.1|40448961 (1)1 (1)0.07
hypothetical protein sscle_14g099920 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
47.1gi|154693234|gb|EDN92972.1|40448961 (1)1 (1)0.07hypothetical protein SS1G_08837 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154693234|gb|EDN92972.1|
gi|156048212|ref|XP_001590073.1|40448961 (1)1 (1)0.07hypothetical protein SS1G_08837 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095458271|gb|APA15222.1|40448961 (1)1 (1)0.07hypothetical protein sscle_14g099920 [Sclerotinia sclerotiorum 1980 UF-70]

-1 peptide matches (1 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
2361  536.2989 1070.5833 1070.5832 0.120400.004+1Score > 32 indicates identity
Score > 28 indicates homology		UK.NNQAAITAIR.K

-48

AccessionScoreDescription
1gi|154703307|gb|EDO03046.1|39hypothetical protein SS1G_05524 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
48.1gi|154703307|gb|EDO03046.1|391411218 (3)5 (1)0.02
hypothetical protein SS1G_05524 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154703307|gb|EDO03046.1|
gi|156056342|ref|XP_001594095.1|391411218 (3)5 (1)0.02
hypothetical protein SS1G_05524 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095455005|gb|APA11962.1|391411218 (3)5 (1)0.02
hypothetical protein sscle_08g067320 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
48.1gi|154703307|gb|EDO03046.1|391411218 (3)5 (1)0.02hypothetical protein SS1G_05524 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154703307|gb|EDO03046.1|
gi|156056342|ref|XP_001594095.1|391411218 (3)5 (1)0.02hypothetical protein SS1G_05524 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095455005|gb|APA11962.1|391411218 (3)5 (1)0.02hypothetical protein sscle_08g067320 [Sclerotinia sclerotiorum 1980 UF-70]

-8 peptide matches (6 non-duplicate, 2 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
251  392.7192 783.4238 783.4351 -14.4091.2+2Score > 27 indicates identity
Score > 23 indicates homology		 R.LRPDQR.A
1549  488.7279 975.4412 975.4257 15.80107.7+6Score > 31 indicates identity R.VNDANGQTR.F + 2 Deamidated (NQ)
1728  500.2830 998.5514 998.5509 0.57190.23+1Score > 31 indicates identity
Score > 15 indicates homology		 K.KSPAAVAAQR.G + Deamidated (NQ)
9049+2 879.4186 1756.8227 1756.8479 -14.31320.002+1Score > 34 indicates identity
Score > 18 indicates homology		UR.LELLQQAKDHSSNGSK.E + 3 Deamidated (NQ)
15526  1377.2124 2752.4102 2752.3879 8.13111+3Score > 34 indicates identity
Score > 13 indicates homology		UR.GIQEKAVLGNASQQGIVNANPSDALAGK.E + 3 Deamidated (NQ)
15543  1377.7113 2753.4080 2753.3719 13.1101+2Score > 34 indicates identity
Score > 13 indicates homology		UR.GIQEKAVLGNASQQGIVNANPSDALAGK.E + 4 Deamidated (NQ)

-49

AccessionScoreDescription
1gi|154691708|gb|EDN91446.1|38hypothetical protein SS1G_00849 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
49.1gi|154691708|gb|EDN91446.1|38166722 (2)1 (1)0.20
hypothetical protein SS1G_00849 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154691708|gb|EDN91446.1|
gi|156065677|ref|XP_001598760.1|38166722 (2)1 (1)0.20
hypothetical protein SS1G_00849 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095450668|gb|APA07630.1|38166722 (2)1 (1)0.20
hypothetical protein sscle_03g024000 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
49.1gi|154691708|gb|EDN91446.1|38166722 (2)1 (1)0.20hypothetical protein SS1G_00849 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154691708|gb|EDN91446.1|
gi|156065677|ref|XP_001598760.1|38166722 (2)1 (1)0.20hypothetical protein SS1G_00849 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095450668|gb|APA07630.1|38166722 (2)1 (1)0.20hypothetical protein sscle_03g024000 [Sclerotinia sclerotiorum 1980 UF-70]

-2 peptide matches (1 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
358+1 404.2295 806.4444 806.4439 0.550340.024+1Score > 32 indicates identity
Score > 30 indicates homology		UR.TFWVVR.Q

-50

AccessionScoreDescription
1gi|154693514|gb|EDN93252.1|38hypothetical protein SS1G_09118 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
50.1gi|154693514|gb|EDN93252.1|38339731 (1)1 (1)0.10
hypothetical protein SS1G_09118 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154693514|gb|EDN93252.1|
gi|156048772|ref|XP_001590353.1|38339731 (1)1 (1)0.10
hypothetical protein SS1G_09118 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095458486|gb|APA15437.1|38339731 (1)1 (1)0.10
hypothetical protein sscle_14g102070 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
50.1gi|154693514|gb|EDN93252.1|38339731 (1)1 (1)0.10hypothetical protein SS1G_09118 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154693514|gb|EDN93252.1|
gi|156048772|ref|XP_001590353.1|38339731 (1)1 (1)0.10hypothetical protein SS1G_09118 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095458486|gb|APA15437.1|38339731 (1)1 (1)0.10hypothetical protein sscle_14g102070 [Sclerotinia sclerotiorum 1980 UF-70]

-1 peptide matches (1 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
1908  510.7601 1019.5056 1019.5036 2.020380.0033+1Score > 34 indicates identity
Score > 26 indicates homology		UR.LSSNQAWSK.G

-51

AccessionScoreDescription
1gi|347830059|emb|CCD45756.1|38glycoside hydrolase family 28 protein [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
51.1gi|347830059|emb|CCD45756.1|38398452 (2)1 (1)0.08
glycoside hydrolase family 28 protein [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
51.1gi|347830059|emb|CCD45756.1|38398452 (2)1 (1)0.08glycoside hydrolase family 28 protein [Botrytis cinerea T4]

-2 peptide matches (1 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
3344+1 580.7777 1159.5409 1159.5404 0.390350.0024+1Score > 32 indicates identity
Score > 21 indicates homology		UR.TCHVSSLGSGR.D

-52

AccessionScoreDescription
1gi|347837081|emb|CCD51653.1|37similar to ubiquitin-protein ligase [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
52.1gi|347837081|emb|CCD51653.1|371348553 (1)3 (1)0.02
similar to ubiquitin-protein ligase [Botrytis cinerea T4]
+3 samesets of gi|347837081|emb|CCD51653.1|
gi|154691227|gb|EDN90965.1|371342952 (1)2 (1)0.02
hypothetical protein SS1G_00365 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156064715|ref|XP_001598279.1|371342952 (1)2 (1)0.02
hypothetical protein SS1G_00365 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095451036|gb|APA07998.1|371348272 (1)2 (1)0.02
hypothetical protein sscle_03g027680 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
52.1gi|347837081|emb|CCD51653.1|371348553 (1)3 (1)0.02similar to ubiquitin-protein ligase [Botrytis cinerea T4]
+3 samesets of gi|347837081|emb|CCD51653.1|
gi|154691227|gb|EDN90965.1|371342952 (1)2 (1)0.02hypothetical protein SS1G_00365 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156064715|ref|XP_001598279.1|371342952 (1)2 (1)0.02hypothetical protein SS1G_00365 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095451036|gb|APA07998.1|371348272 (1)2 (1)0.02hypothetical protein sscle_03g027680 [Sclerotinia sclerotiorum 1980 UF-70]

-3 peptide matches (3 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
264  393.2465 784.4784 784.4807 -2.910370.011+1Score > 30 indicates identityUR.AALEILR.Y
2851  557.8144 1113.6142 1113.6441 -26.8235.2+8Score > 32 indicates identity
Score > 23 indicates homology		UK.RKIMAAVGPR.I + Oxidation (M)
4179  411.2203 1230.6392 1230.6357 2.871130.55+1Score > 34 indicates identity
Score > 23 indicates homology		UR.IFPDRADEIR.M

-53

AccessionScoreDescription
1gi|154693707|gb|EDN93445.1|37hypothetical protein SS1G_09311 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
53.1gi|154693707|gb|EDN93445.1|37782162 (1)2 (1)0.04
hypothetical protein SS1G_09311 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154693707|gb|EDN93445.1|
gi|156046070|ref|XP_001589590.1|37782162 (1)2 (1)0.04
hypothetical protein SS1G_09311 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095458871|gb|APA15821.1|37824362 (1)2 (1)0.04
hypothetical protein sscle_15g105910 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
53.1gi|154693707|gb|EDN93445.1|37782162 (1)2 (1)0.04hypothetical protein SS1G_09311 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154693707|gb|EDN93445.1|
gi|156046070|ref|XP_001589590.1|37782162 (1)2 (1)0.04hypothetical protein SS1G_09311 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095458871|gb|APA15821.1|37824362 (1)2 (1)0.04hypothetical protein sscle_15g105910 [Sclerotinia sclerotiorum 1980 UF-70]

-2 peptide matches (2 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
1204  466.7430 931.4714 931.4835 -13.02370.03+1Score > 34 indicates identityUR.SSSPRRDK.R
4709  638.8137 1275.6129 1275.6306 -13.9170.81+1Score > 34 indicates identity
Score > 18 indicates homology		 R.DNTKNEELVSK.A

-54

AccessionScoreDescription
1gi|154691632|gb|EDN91370.1|36hypothetical protein SS1G_00773 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
54.1gi|154691632|gb|EDN91370.1|361901146 (1)4 (1)0.02
hypothetical protein SS1G_00773 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154691632|gb|EDN91370.1|
gi|156065525|ref|XP_001598684.1|361901146 (1)4 (1)0.02
hypothetical protein SS1G_00773 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095450715|gb|APA07677.1|361295145 (1)3 (1)0.03
hypothetical protein sscle_03g024470 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
54.1gi|154691632|gb|EDN91370.1|361901146 (1)4 (1)0.02hypothetical protein SS1G_00773 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154691632|gb|EDN91370.1|
gi|156065525|ref|XP_001598684.1|361901146 (1)4 (1)0.02hypothetical protein SS1G_00773 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095450715|gb|APA07677.1|361295145 (1)3 (1)0.03hypothetical protein sscle_03g024470 [Sclerotinia sclerotiorum 1980 UF-70]

-6 peptide matches (5 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
273+1 394.7351 787.4555 787.4552 0.46081.9+4Score > 33 indicates identity
Score > 23 indicates homology		UK.LSALQTR.D
387  408.2252 814.4358 814.4409 -6.34143.1+8Score > 32 indicates identity
Score > 22 indicates homology		 R.DQLRAGR.G
481  416.7477 831.4809 831.4814 -0.551360.02+1Score > 32 indicates identityUR.SISLEKR.A
8383  837.9076 1673.8007 1673.8043 -2.12021+2Score > 34 indicates identity
Score > 15 indicates homology		UR.TQALSCPIGDDIQTR.M
8405  838.4071 1674.7996 1674.7883 6.78001+3Score > 34 indicates identity
Score > 13 indicates homology		UR.TQALSCPIGDDIQTR.M + Deamidated (NQ)

-55

AccessionScoreDescription
1gi|154703678|gb|EDO03417.1|36hypothetical protein SS1G_05898 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
55.1gi|154703678|gb|EDO03417.1|36897744 (1)1 (1)0.04
hypothetical protein SS1G_05898 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154703678|gb|EDO03417.1|
gi|156054100|ref|XP_001592976.1|36897744 (1)1 (1)0.04
hypothetical protein SS1G_05898 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095452910|gb|APA09870.1|36925114 (1)1 (1)0.04
hypothetical protein sscle_05g046400 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
55.1gi|154703678|gb|EDO03417.1|36897744 (1)1 (1)0.04hypothetical protein SS1G_05898 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154703678|gb|EDO03417.1|
gi|156054100|ref|XP_001592976.1|36897744 (1)1 (1)0.04hypothetical protein SS1G_05898 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095452910|gb|APA09870.1|36925114 (1)1 (1)0.04hypothetical protein sscle_05g046400 [Sclerotinia sclerotiorum 1980 UF-70]

-4 peptide matches (1 non-duplicate, 3 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
767+3 436.7364 871.4583 871.4837 -29.10360.016+1Score > 31 indicates identityUK.QLAAMIPK.Y + Deamidated (NQ)

-56

AccessionScoreDescription
1gi|347830591|emb|CCD46288.1|35similar to calcium-transporting P-type ATPase [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
56.1gi|347830591|emb|CCD46288.1|351191148 (1)7 (1)0.03
similar to calcium-transporting P-type ATPase [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
56.1gi|347830591|emb|CCD46288.1|351191148 (1)7 (1)0.03similar to calcium-transporting P-type ATPase [Botrytis cinerea T4]

-8 peptide matches (7 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
584  424.2479 846.4813 846.4923 -13.0121.9+5Score > 32 indicates identity
Score > 17 indicates homology		UR.TGVSKSIR.R
1214  467.2355 932.4564 932.4788 -24.02350.041+1Score > 34 indicates identityUR.DRANSKSR.H
1286  473.2217 944.4288 944.4563 -29.1024.4+8Score > 29 indicates identity
Score > 21 indicates homology		 R.IGNIANNAR.L + 3 Deamidated (NQ)
2335  534.8060 1067.5974 1067.5658 29.6131.8+9Score > 29 indicates identity
Score > 18 indicates homology		 R.MARHNAIVR.K + Deamidated (NQ)
2997  564.3187 1126.6229 1126.6168 5.39161.3+3Score > 31 indicates identity
Score > 19 indicates homology		UK.KLGMPIAEPR.A + Oxidation (M)
5275  664.3519 1326.6892 1326.7255 -27.4112.4+3Score > 33 indicates identity
Score > 18 indicates homology		 R.ILRIGNIANNAR.L + 3 Deamidated (NQ)
21688+1 930.1608 3716.6140 3716.7046 -24.4121+1Score > 33 indicates identity
Score > 15 indicates homology		UR.TPAWPPSVRDRPEAEALMAGSGSDADSSMAEAVSQK.T + Oxidation (M)

-57

AccessionScoreDescription
1gi|347836319|emb|CCD50891.1|35glycoside hydrolase family 3 protein [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
57.1gi|347836319|emb|CCD50891.1|35954683 (1)2 (1)0.03
glycoside hydrolase family 3 protein [Botrytis cinerea T4]
+3 samesets of gi|347836319|emb|CCD50891.1|
gi|154704924|gb|EDO04663.1|35963682 (1)2 (1)0.03
beta-glucosidase 1 precursor [Sclerotinia sclerotiorum 1980 UF-70]
gi|156051478|ref|XP_001591700.1|35963682 (1)2 (1)0.03
beta-glucosidase 1 precursor [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095453421|gb|APA10380.1|35963682 (1)2 (1)0.03
hypothetical protein sscle_06g051500 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
57.1gi|347836319|emb|CCD50891.1|35954683 (1)2 (1)0.03glycoside hydrolase family 3 protein [Botrytis cinerea T4]
+3 samesets of gi|347836319|emb|CCD50891.1|
gi|154704924|gb|EDO04663.1|35963682 (1)2 (1)0.03beta-glucosidase 1 precursor [Sclerotinia sclerotiorum 1980 UF-70]
gi|156051478|ref|XP_001591700.1|35963682 (1)2 (1)0.03beta-glucosidase 1 precursor [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095453421|gb|APA10380.1|35963682 (1)2 (1)0.03hypothetical protein sscle_06g051500 [Sclerotinia sclerotiorum 1980 UF-70]

-3 peptide matches (3 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
2280  531.7726 1061.5306 1061.5294 1.090350.0043+1Score > 34 indicates identity
Score > 24 indicates homology		UR.TPFTWGPTR.E
4946  648.8666 1295.7186 1295.7197 -0.850210.074+1Score > 30 indicates identity
Score > 22 indicates homology		UK.NTNNALPLSKPK.F
4954  649.3519 1296.6893 1296.7037 -11.1051+1Score > 32 indicates identity
Score > 17 indicates homology		UK.NTNNALPLSKPK.F + Deamidated (NQ)

-58

AccessionScoreDescription
1gi|154703202|gb|EDO02941.1|34hypothetical protein SS1G_05418 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
58.1gi|154703202|gb|EDO02941.1|34104682 (1)1 (1)0.33
hypothetical protein SS1G_05418 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154703202|gb|EDO02941.1|
gi|156056132|ref|XP_001593990.1|34104682 (1)1 (1)0.33
hypothetical protein SS1G_05418 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347828992|emb|CCD44689.1|34104382 (1)1 (1)0.33
similar to NADH-ubiquinone oxidoreductase subunit [Botrytis cinerea T4]
gi|1095454933|gb|APA11890.1|34104682 (1)1 (1)0.33
hypothetical protein sscle_08g066600 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
58.1gi|154703202|gb|EDO02941.1|34104682 (1)1 (1)0.33hypothetical protein SS1G_05418 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154703202|gb|EDO02941.1|
gi|156056132|ref|XP_001593990.1|34104682 (1)1 (1)0.33hypothetical protein SS1G_05418 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347828992|emb|CCD44689.1|34104382 (1)1 (1)0.33similar to NADH-ubiquinone oxidoreductase subunit [Botrytis cinerea T4]
gi|1095454933|gb|APA11890.1|34104682 (1)1 (1)0.33hypothetical protein sscle_08g066600 [Sclerotinia sclerotiorum 1980 UF-70]

-2 peptide matches (1 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
4575+1 631.8217 1261.6288 1261.6038 19.80340.0096+1Score > 34 indicates identity
Score > 27 indicates homology		UR.EVSEDLAGLSDK.E

-59

AccessionScoreDescription
1gi|154693400|gb|EDN93138.1|33predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
59.1gi|154693400|gb|EDN93138.1|3372593 (1)1 (1)0.49
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154693400|gb|EDN93138.1|
gi|156048544|ref|XP_001590239.1|3372593 (1)1 (1)0.49
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
59.1gi|154693400|gb|EDN93138.1|3372593 (1)1 (1)0.49predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154693400|gb|EDN93138.1|
gi|156048544|ref|XP_001590239.1|3372593 (1)1 (1)0.49predicted protein [Sclerotinia sclerotiorum 1980 UF-70]

-3 peptide matches (1 non-duplicate, 2 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
2579+2 546.7621 1091.5096 1091.5281 -16.90330.056+1Score > 33 indicates identityUM.TSSLEMGGLR.S + Acetyl (Protein N-term)

-60

AccessionScoreDescription
1gi|347826976|emb|CCD42673.1|32hypothetical protein BofuT4_P074750.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
60.1gi|347826976|emb|CCD42673.1|32498143 (1)2 (1)0.07
hypothetical protein BofuT4_P074750.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
60.1gi|347826976|emb|CCD42673.1|32498143 (1)2 (1)0.07hypothetical protein BofuT4_P074750.1 [Botrytis cinerea T4]

-3 peptide matches (2 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
368+1 405.2237 808.4329 808.4443 -14.10320.03+1Score > 30 indicates identityUR.LASLYSR.E
4916  431.5726 1291.6961 1291.6958 0.20155.9+5Score > 32 indicates identity
Score > 25 indicates homology		UK.LLKWMQTAIR.I + Deamidated (NQ); Dioxidation (W)

-61

AccessionScoreDescription
1gi|347842042|emb|CCD56614.1|32similar to MFS multidrug transporter [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
61.1gi|347842042|emb|CCD56614.1|32611432 (1)2 (1)0.05
similar to MFS multidrug transporter [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
61.1gi|347842042|emb|CCD56614.1|32611432 (1)2 (1)0.05similar to MFS multidrug transporter [Botrytis cinerea T4]

-2 peptide matches (2 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
5  351.2005 700.3864 700.3868 -0.560320.048+1Score > 32 indicates identityUR.IGDIAGR.K
2518  543.7873 1085.5601 1085.5717 -10.61811+5Score > 32 indicates identity
Score > 31 indicates homology		UK.KNPVTIEQR.F + 2 Deamidated (NQ)

-62

AccessionScoreDescription
1gi|154692782|gb|EDN92520.1|32hypothetical protein SS1G_08383 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
62.1gi|154692782|gb|EDN92520.1|32440117 (1)4 (1)0.08
hypothetical protein SS1G_08383 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154692782|gb|EDN92520.1|
gi|156049353|ref|XP_001590643.1|32440117 (1)4 (1)0.08
hypothetical protein SS1G_08383 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095455954|gb|APA12909.1|32440117 (1)4 (1)0.08
hypothetical protein sscle_10g076790 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
62.1gi|154692782|gb|EDN92520.1|32440117 (1)4 (1)0.08hypothetical protein SS1G_08383 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154692782|gb|EDN92520.1|
gi|156049353|ref|XP_001590643.1|32440117 (1)4 (1)0.08hypothetical protein SS1G_08383 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095455954|gb|APA12909.1|32440117 (1)4 (1)0.08hypothetical protein sscle_10g076790 [Sclerotinia sclerotiorum 1980 UF-70]

-7 peptide matches (4 non-duplicate, 3 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
199+1 388.2313 774.4481 774.4487 -0.790200.83+1Score > 32 indicates identityUK.TALLTEK.T
345+2 403.2263 804.4380 804.4382 -0.160320.0064+1Score > 34 indicates identity
Score > 23 indicates homology		UR.VFSIDPK.T
1520  486.7953 971.5760 971.5876 -11.91132+3Score > 32 indicates identity
Score > 28 indicates homology		UR.SARVAIVTR.D
12218  1083.0438 2164.0731 2164.1092 -16.7201.3+3Score > 35 indicates identity
Score > 14 indicates homology		UR.QMSMNKAGTLVAVALQRSAR.V + Deamidated (NQ); 2 Oxidation (M)

-63

AccessionScoreDescription
1gi|347828896|emb|CCD44593.1|32hypothetical protein BofuT4_P054940.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
63.1gi|347828896|emb|CCD44593.1|32331192 (1)2 (1)0.10
hypothetical protein BofuT4_P054940.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
63.1gi|347828896|emb|CCD44593.1|32331192 (1)2 (1)0.10hypothetical protein BofuT4_P054940.1 [Botrytis cinerea T4]

-2 peptide matches (2 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
831  441.7743 881.5341 881.5447 -12.00320.013+1Score > 25 indicates identityUR.IIEVRPR.T
22892  1024.2438 4092.9460 4092.9336 3.02121+4Score > 35 indicates identity
Score > 15 indicates homology		UR.YFDDIWGASESCSLNMNSALLEFKNLDELVIVVER.T + Deamidated (NQ); Oxidation (M)

-64

AccessionScoreDescription
1gi|347835016|emb|CCD49588.1|32similar to leucine rich repeat domain-containing protein [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
64.1gi|347835016|emb|CCD49588.1|329377439 (1)4 (1)0.03
similar to leucine rich repeat domain-containing protein [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
64.1gi|347835016|emb|CCD49588.1|329377439 (1)4 (1)0.03similar to leucine rich repeat domain-containing protein [Botrytis cinerea T4]

-39 peptide matches (5 non-duplicate, 34 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
972+33 450.2731 898.5316 898.5236 8.880320.031+1Score > 29 indicates identityUR.INTSVLPR.L
978+1 450.7609 899.5073 899.5076 -0.340230.1+2Score > 32 indicates identity
Score > 26 indicates homology		UR.INTSVLPR.L + Deamidated (NQ)
1329  476.2301 950.4456 950.4682 -23.8032.4+5Score > 32 indicates identity
Score > 19 indicates homology		 R.TGSSHGHLR.G
6512  729.8805 1457.7465 1457.7725 -17.8013.5+8Score > 34 indicates identity
Score > 19 indicates homology		 K.NISALEISDIDIR.Q
8067  546.9432 1637.8077 1637.8202 -7.61162+5Score > 34 indicates identity
Score > 21 indicates homology		UR.QFFGWDKLAEQLR.S + Deamidated (NQ)

-65

AccessionScoreDescription
1gi|154705300|gb|EDO05039.1|31hypothetical protein SS1G_07524 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
65.1gi|154705300|gb|EDO05039.1|31346914 (1)3 (1)0.10
hypothetical protein SS1G_07524 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154705300|gb|EDO05039.1|
gi|156052230|ref|XP_001592076.1|31346914 (1)3 (1)0.10
hypothetical protein SS1G_07524 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347839725|emb|CCD54297.1|31346624 (1)3 (1)0.10
similar to succinyl-CoA ligase subunit alpha [Botrytis cinerea T4]
gi|1095453137|gb|APA10096.1|31346914 (1)3 (1)0.10
hypothetical protein sscle_06g048660 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
65.1gi|154705300|gb|EDO05039.1|31346914 (1)3 (1)0.10hypothetical protein SS1G_07524 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154705300|gb|EDO05039.1|
gi|156052230|ref|XP_001592076.1|31346914 (1)3 (1)0.10hypothetical protein SS1G_07524 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347839725|emb|CCD54297.1|31346624 (1)3 (1)0.10similar to succinyl-CoA ligase subunit alpha [Botrytis cinerea T4]
gi|1095453137|gb|APA10096.1|31346914 (1)3 (1)0.10hypothetical protein sscle_06g048660 [Sclerotinia sclerotiorum 1980 UF-70]

-4 peptide matches (3 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
3009+1 564.8259 1127.6372 1127.6161 18.70310.031+1Score > 32 indicates identity
Score > 29 indicates homology		UK.IGIMPGFIHK.R + Oxidation (M)
4312  620.8414 1239.6683 1239.6506 14.3121.2+3Score > 31 indicates identity
Score > 15 indicates homology		UR.RMGHAGAIVSGGK.G
9842  926.9145 1851.8144 1851.8654 -27.5104.5+4Score > 32 indicates identity
Score > 19 indicates homology		UM.QAFSRCARPAMQAAMR.R + Deamidated (NQ)

-66

AccessionScoreDescription
1gi|347836616|emb|CCD51188.1|31similar to plasma membrane ATPase [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
66.1gi|347836616|emb|CCD51188.1|31966133 (1)2 (1)0.03
similar to plasma membrane ATPase [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
66.1gi|347836616|emb|CCD51188.1|31966133 (1)2 (1)0.03similar to plasma membrane ATPase [Botrytis cinerea T4]

-3 peptide matches (2 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
4588  632.3142 1262.6137 1262.6506 -29.2061.2+3Score > 34 indicates identity
Score > 19 indicates homology		 K.YNVVEILQQR.G + 2 Deamidated (NQ)
6606+1 737.4014 1472.7882 1472.7947 -4.412310.02+1Score > 33 indicates identity
Score > 26 indicates homology		UR.IGLTDSEVQARRK.K + Deamidated (NQ)

-67

AccessionScoreDescription
1gi|347839226|emb|CCD53798.1|30similar to copper radical oxidase [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
67.1gi|347839226|emb|CCD53798.1|301154374 (1)3 (1)0.03
similar to copper radical oxidase [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
67.1gi|347839226|emb|CCD53798.1|301154374 (1)3 (1)0.03similar to copper radical oxidase [Botrytis cinerea T4]

-4 peptide matches (3 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
92+1 368.7155 735.4164 735.4167 -0.360300.038+1Score > 29 indicates identityUK.ISFLEK.F
2916  560.7664 1119.5183 1119.4979 18.20170.056+1Score > 33 indicates identity
Score > 17 indicates homology		UK.GCLTDDAVNR.V
17470  984.5258 2950.5556 2950.5764 -7.02101+1Score > 32 indicates identity
Score > 13 indicates homology		UR.ILDEVTLQTQRVLPNIPAAVNNFLGGR.T + 3 Deamidated (NQ)

-68

AccessionScoreDescription
1gi|154693787|gb|EDN93525.1|30hypothetical protein SS1G_09392 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
68.1gi|154693787|gb|EDN93525.1|30425574 (1)2 (1)0.08
hypothetical protein SS1G_09392 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154693787|gb|EDN93525.1|
gi|156046276|ref|XP_001589670.1|30425574 (1)2 (1)0.08
hypothetical protein SS1G_09392 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095458818|gb|APA15768.1|30425574 (1)2 (1)0.08
hypothetical protein sscle_15g105380 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
68.1gi|154693787|gb|EDN93525.1|30425574 (1)2 (1)0.08hypothetical protein SS1G_09392 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154693787|gb|EDN93525.1|
gi|156046276|ref|XP_001589670.1|30425574 (1)2 (1)0.08hypothetical protein SS1G_09392 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095458818|gb|APA15768.1|30425574 (1)2 (1)0.08hypothetical protein sscle_15g105380 [Sclerotinia sclerotiorum 1980 UF-70]

-4 peptide matches (2 non-duplicate, 2 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
1580+1 491.2144 980.4142 980.4134 0.840170.21+1Score > 29 indicates identity
Score > 23 indicates homology		 R.SGPCGYNAR.V
8733+1 860.3590 1718.7033 1718.6995 2.240300.029+1Score > 27 indicates identityUR.NDWFTCNEFNSGTK.C

-69

AccessionScoreDescription
1gi|154699709|gb|EDN99447.1|30hypothetical protein SS1G_02301 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
69.1gi|154699709|gb|EDN99447.1|30941574 (1)2 (1)0.03
hypothetical protein SS1G_02301 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154699709|gb|EDN99447.1|
gi|156060325|ref|XP_001596085.1|30941574 (1)2 (1)0.03
hypothetical protein SS1G_02301 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095451626|gb|APA08587.1|30941574 (1)2 (1)0.03
hypothetical protein sscle_04g033570 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
69.1gi|154699709|gb|EDN99447.1|30941574 (1)2 (1)0.03hypothetical protein SS1G_02301 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154699709|gb|EDN99447.1|
gi|156060325|ref|XP_001596085.1|30941574 (1)2 (1)0.03hypothetical protein SS1G_02301 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095451626|gb|APA08587.1|30941574 (1)2 (1)0.03hypothetical protein sscle_04g033570 [Sclerotinia sclerotiorum 1980 UF-70]

-4 peptide matches (2 non-duplicate, 2 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
2451  540.7535 1079.4925 1079.5103 -16.5211.6+9Score > 32 indicates identity
Score > 15 indicates homology		UR.EMKEREMK.K
4623+2 633.7942 1265.5738 1265.6074 -26.50300.0095+1Score > 32 indicates identity
Score > 22 indicates homology		UK.GNQIYMELAAR.Y + Deamidated (NQ)

-70

AccessionScoreDescription
1gi|347826739|emb|CCD42436.1|30similar to nuclear cohesin complex subunit (Psc3) [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
70.1gi|347826739|emb|CCD42436.1|301314132 (1)2 (1)0.02
similar to nuclear cohesin complex subunit (Psc3) [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
70.1gi|347826739|emb|CCD42436.1|301314132 (1)2 (1)0.02similar to nuclear cohesin complex subunit (Psc3) [Botrytis cinerea T4]

-2 peptide matches (2 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
146  379.7115 757.4085 757.4082 0.38103.4+10Score > 31 indicates identity
Score > 18 indicates homology		 K.NKRPNK.G + 2 Deamidated (NQ)
4133  614.8360 1227.6574 1227.6207 29.90300.0067+1Score > 33 indicates identity
Score > 21 indicates homology		UK.AQQAAAEAAAQAK.K

-71

AccessionScoreDescription
1gi|154702642|gb|EDO02381.1|30hypothetical protein SS1G_04857 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
71.1gi|154702642|gb|EDO02381.1|30149941 (1)1 (1)0.23
hypothetical protein SS1G_04857 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154702642|gb|EDO02381.1|
gi|156055012|ref|XP_001593430.1|30149941 (1)1 (1)0.23
hypothetical protein SS1G_04857 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095454502|gb|APA11459.1|30149941 (1)1 (1)0.23
hypothetical protein sscle_08g062290 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
71.1gi|154702642|gb|EDO02381.1|30149941 (1)1 (1)0.23hypothetical protein SS1G_04857 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154702642|gb|EDO02381.1|
gi|156055012|ref|XP_001593430.1|30149941 (1)1 (1)0.23hypothetical protein SS1G_04857 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095454502|gb|APA11459.1|30149941 (1)1 (1)0.23hypothetical protein sscle_08g062290 [Sclerotinia sclerotiorum 1980 UF-70]

-1 peptide matches (1 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
1397  479.2285 956.4424 956.4426 -0.160300.045+1Score > 29 indicates identityUK.CTYSLWK.G

-72

AccessionScoreDescription
1gi|347841454|emb|CCD56026.1|29hypothetical protein BofuT4_P151580.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
72.1gi|347841454|emb|CCD56026.1|29889889 (1)7 (1)0.04
hypothetical protein BofuT4_P151580.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
72.1gi|347841454|emb|CCD56026.1|29889889 (1)7 (1)0.04hypothetical protein BofuT4_P151580.1 [Botrytis cinerea T4]

-9 peptide matches (7 non-duplicate, 2 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
135+1 377.1892 752.3638 752.3785 -19.6290.4+1Score > 30 indicates identity
Score > 17 indicates homology		 K.KRMMR.R + 2 Oxidation (M)
208  389.2487 776.4829 776.4657 22.1171.8+3Score > 25 indicates identity
Score > 22 indicates homology		 R.RSLFVR.S
452  414.2403 826.4661 826.4548 13.6014.2+5Score > 27 indicates identity
Score > 20 indicates homology		 K.IEIAQPR.S + Deamidated (NQ)
1649  494.2765 986.5384 986.5396 -1.23132.2+5Score > 34 indicates identity
Score > 19 indicates homology		 K.AVEKDQAVK.L
2426  538.7922 1075.5698 1075.5622 7.11216.2+6Score > 33 indicates identity
Score > 21 indicates homology		UR.NRSKEVTDK.I
3853  602.3019 1202.5892 1202.6142 -20.8111.5+3Score > 34 indicates identity
Score > 15 indicates homology		UR.QQLSKEEIAR.G + 2 Deamidated (NQ)
5566+1 679.3628 1356.7111 1356.7361 -18.42290.025+1Score > 33 indicates identity
Score > 26 indicates homology		UK.KNAEKALAAINGR.E + 2 Deamidated (NQ)

-73

AccessionScoreDescription
1gi|347835919|emb|CCD50491.1|29similar to myo-inositol-1-phosphate synthase [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
73.1gi|347835919|emb|CCD50491.1|29594245 (2)3 (1)0.06
similar to myo-inositol-1-phosphate synthase [Botrytis cinerea T4]
+3 samesets of gi|347835919|emb|CCD50491.1|
gi|154691870|gb|EDN91608.1|29588234 (2)2 (1)0.06
conserved hypothetical protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|156066001|ref|XP_001598922.1|29588234 (2)2 (1)0.06
conserved hypothetical protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095450540|gb|APA07502.1|29588234 (2)2 (1)0.06
hypothetical protein sscle_03g022720 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
73.1gi|347835919|emb|CCD50491.1|29594245 (2)3 (1)0.06similar to myo-inositol-1-phosphate synthase [Botrytis cinerea T4]
+3 samesets of gi|347835919|emb|CCD50491.1|
gi|154691870|gb|EDN91608.1|29588234 (2)2 (1)0.06conserved hypothetical protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|156066001|ref|XP_001598922.1|29588234 (2)2 (1)0.06conserved hypothetical protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095450540|gb|APA07502.1|29588234 (2)2 (1)0.06hypothetical protein sscle_03g022720 [Sclerotinia sclerotiorum 1980 UF-70]

-5 peptide matches (3 non-duplicate, 2 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
1293+2 473.7718 945.5290 945.5144 15.41280.016+1Score > 33 indicates identity
Score > 22 indicates homology		UR.RGLSWATR.E
1636  493.7328 985.4511 985.4287 22.7021+2Score > 29 indicates identity
Score > 14 indicates homology		UK.ACNEHVEK.I
21773  1244.9396 3731.7969 3731.8781 -21.8201+2Score > 36 indicates identity
Score > 13 indicates homology		UK.NDLDKVIVLWTANTERFAELIDGVNDTAENLLK.A + 3 Deamidated (NQ)

-74

AccessionScoreDescription
1gi|154695368|gb|EDN95106.1|29hypothetical protein SS1G_10981 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
74.1gi|154695368|gb|EDN95106.1|29585507 (1)1 (1)0.06
hypothetical protein SS1G_10981 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154695368|gb|EDN95106.1|
gi|156042368|ref|XP_001587741.1|29585507 (1)1 (1)0.06
hypothetical protein SS1G_10981 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095457213|gb|APA14166.1|29585507 (1)1 (1)0.06
hypothetical protein sscle_12g089360 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
74.1gi|154695368|gb|EDN95106.1|29585507 (1)1 (1)0.06hypothetical protein SS1G_10981 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154695368|gb|EDN95106.1|
gi|156042368|ref|XP_001587741.1|29585507 (1)1 (1)0.06hypothetical protein SS1G_10981 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095457213|gb|APA14166.1|29585507 (1)1 (1)0.06hypothetical protein sscle_12g089360 [Sclerotinia sclerotiorum 1980 UF-70]

-7 peptide matches (2 non-duplicate, 5 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
6998+3 757.9123 1513.8101 1513.8352 -16.51290.033+1Score > 33 indicates identity
Score > 26 indicates homology		UK.VLGVSKDADELQIK.S
7009+2 758.4041 1514.7937 1514.8192 -16.81150.37+1Score > 34 indicates identity
Score > 23 indicates homology		UK.VLGVSKDADELQIK.S + Deamidated (NQ)

-75

AccessionScoreDescription
1gi|154693995|gb|EDN93733.1|28predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
75.1gi|154693995|gb|EDN93733.1|28415815 (2)2 (1)0.08
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
+6 samesets of gi|154693995|gb|EDN93733.1|
gi|156047821|ref|XP_001589878.1|28415815 (2)2 (1)0.08
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095458647|gb|APA15597.1|28447725 (2)2 (1)0.07
hypothetical protein sscle_15g103670 [Sclerotinia sclerotiorum 1980 UF-70]
gi|154701096|gb|EDO00835.1|28123773 (2)1 (1)0.28
hypothetical protein SS1G_03309 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156058594|ref|XP_001595220.1|28123773 (2)1 (1)0.28
hypothetical protein SS1G_03309 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347839374|emb|CCD53946.1|2887803 (2)1 (1)0.40
similar to NADH-ubiquinone oxidoreductase 9.5 kDa subunit [Botrytis cinerea T4]
gi|1095454035|gb|APA10993.1|28123773 (2)1 (1)0.28
hypothetical protein sscle_07g057630 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
75.1gi|154693995|gb|EDN93733.1|28415815 (2)2 (1)0.08predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
+6 samesets of gi|154693995|gb|EDN93733.1|
gi|156047821|ref|XP_001589878.1|28415815 (2)2 (1)0.08predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095458647|gb|APA15597.1|28447725 (2)2 (1)0.07hypothetical protein sscle_15g103670 [Sclerotinia sclerotiorum 1980 UF-70]
gi|154701096|gb|EDO00835.1|28123773 (2)1 (1)0.28hypothetical protein SS1G_03309 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156058594|ref|XP_001595220.1|28123773 (2)1 (1)0.28hypothetical protein SS1G_03309 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347839374|emb|CCD53946.1|2887803 (2)1 (1)0.40similar to NADH-ubiquinone oxidoreductase 9.5 kDa subunit [Botrytis cinerea T4]
gi|1095454035|gb|APA10993.1|28123773 (2)1 (1)0.28hypothetical protein sscle_07g057630 [Sclerotinia sclerotiorum 1980 UF-70]

-5 peptide matches (3 non-duplicate, 2 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
1177+2 464.7301 927.4457 927.4450 0.741310.039+1Score > 30 indicates identityUR.FFSKEDR.K
1234  468.7429 935.4713 935.4712 0.087012.8+7Score > 33 indicates identity
Score > 18 indicates homology		UK.NLELYQR.M + Deamidated (NQ)
1236  468.7480 935.4814 935.4712 10.9021+2Score > 33 indicates identity
Score > 15 indicates homology		UK.NLELYQR.M + Deamidated (NQ)

-76

AccessionScoreDescription
1gi|347441989|emb|CCD34910.1|28hypothetical protein BofuT4_P086140.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
76.1gi|347441989|emb|CCD34910.1|28410266 (1)2 (1)0.08
hypothetical protein BofuT4_P086140.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
76.1gi|347441989|emb|CCD34910.1|28410266 (1)2 (1)0.08hypothetical protein BofuT4_P086140.1 [Botrytis cinerea T4]

-6 peptide matches (2 non-duplicate, 4 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
1769  503.7508 1005.4871 1005.5066 -19.4111.8+5Score > 34 indicates identity
Score > 16 indicates homology		U-.MNFPTPRK.R + Oxidation (M)
6626+4 738.3958 1474.7771 1474.7813 -2.882280.061+1Score > 35 indicates identity
Score > 28 indicates homology		UR.EVMNRLEAKELK.N + Oxidation (M)

-77

AccessionScoreDescription
1gi|347827155|emb|CCD42852.1|28hypothetical protein BofuT4_P071480.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
77.1gi|347827155|emb|CCD42852.1|28449643 (1)2 (1)0.07
hypothetical protein BofuT4_P071480.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
77.1gi|347827155|emb|CCD42852.1|28449643 (1)2 (1)0.07hypothetical protein BofuT4_P071480.1 [Botrytis cinerea T4]

-3 peptide matches (2 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
196  387.7293 773.4441 773.4395 5.93160.99+1Score > 35 indicates identity
Score > 18 indicates homology		UK.AKTTPTR.K
7517+1 784.3771 1566.7397 1566.7672 -17.51280.012+1Score > 34 indicates identity
Score > 21 indicates homology		U-.MTTTRSGLNSASNVK.Q + Deamidated (NQ)

-78

AccessionScoreDescription
1gi|154697145|gb|EDN96883.1|28hypothetical protein SS1G_01811 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
78.1gi|154697145|gb|EDN96883.1|28512363 (1)1 (1)0.06
hypothetical protein SS1G_01811 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154697145|gb|EDN96883.1|
gi|156063386|ref|XP_001597615.1|28512363 (1)1 (1)0.06
hypothetical protein SS1G_01811 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095448853|gb|APA05817.1|28667113 (1)1 (1)0.05
hypothetical protein sscle_01g005870 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
78.1gi|154697145|gb|EDN96883.1|28512363 (1)1 (1)0.06hypothetical protein SS1G_01811 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154697145|gb|EDN96883.1|
gi|156063386|ref|XP_001597615.1|28512363 (1)1 (1)0.06hypothetical protein SS1G_01811 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095448853|gb|APA05817.1|28667113 (1)1 (1)0.05hypothetical protein sscle_01g005870 [Sclerotinia sclerotiorum 1980 UF-70]

-3 peptide matches (2 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
3387  582.3062 1162.5977 1162.5983 -0.430280.0038+1Score > 34 indicates identity
Score > 16 indicates homology		UR.QLGGVVDSNFK.V
3412+1 583.2936 1164.5727 1164.5663 5.55023+7Score > 34 indicates identity
Score > 20 indicates homology		UR.QLGGVVDSNFK.V + 2 Deamidated (NQ)

-79

AccessionScoreDescription
1gi|154696763|gb|EDN96501.1|28hypothetical protein SS1G_01427 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
79.1gi|154696763|gb|EDN96501.1|28402222 (1)1 (1)0.08
hypothetical protein SS1G_01427 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154696763|gb|EDN96501.1|
gi|156062622|ref|XP_001597233.1|28402222 (1)1 (1)0.08
hypothetical protein SS1G_01427 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347838630|emb|CCD53202.1|28364162 (1)1 (1)0.09
hypothetical protein BofuT4_P122210.1 [Botrytis cinerea T4]
gi|1095449160|gb|APA06124.1|28396072 (1)1 (1)0.08
hypothetical protein sscle_01g008940 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
79.1gi|154696763|gb|EDN96501.1|28402222 (1)1 (1)0.08hypothetical protein SS1G_01427 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154696763|gb|EDN96501.1|
gi|156062622|ref|XP_001597233.1|28402222 (1)1 (1)0.08hypothetical protein SS1G_01427 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347838630|emb|CCD53202.1|28364162 (1)1 (1)0.09hypothetical protein BofuT4_P122210.1 [Botrytis cinerea T4]
gi|1095449160|gb|APA06124.1|28396072 (1)1 (1)0.08hypothetical protein sscle_01g008940 [Sclerotinia sclerotiorum 1980 UF-70]

-2 peptide matches (1 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
7330+1 774.8092 1547.6038 1547.6054 -1.031280.023+1Score > 24 indicates identityUK.DFKECMEQCSAK.A + Oxidation (M)

-80

AccessionScoreDescription
1gi|154696419|gb|EDN96157.1|27hypothetical protein SS1G_01081 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
80.1gi|154696419|gb|EDN96157.1|277821610 (2)7 (2)0.09
hypothetical protein SS1G_01081 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154696419|gb|EDN96157.1|
gi|156061934|ref|XP_001596889.1|277821610 (2)7 (2)0.09
hypothetical protein SS1G_01081 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449422|gb|APA06386.1|277821610 (2)7 (2)0.09
hypothetical protein sscle_01g011560 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347835715|emb|CCD50287.1|27785996 (2)4 (2)0.09
cat2, catalase [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
80.1gi|154696419|gb|EDN96157.1|277821610 (2)7 (2)0.09hypothetical protein SS1G_01081 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154696419|gb|EDN96157.1|
gi|156061934|ref|XP_001596889.1|277821610 (2)7 (2)0.09hypothetical protein SS1G_01081 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449422|gb|APA06386.1|277821610 (2)7 (2)0.09hypothetical protein sscle_01g011560 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347835715|emb|CCD50287.1|27785996 (2)4 (2)0.09cat2, catalase [Botrytis cinerea T4]

-10 peptide matches (7 non-duplicate, 3 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
431+1 412.7166 823.4187 823.4188 -0.120310.04+1Score > 30 indicates identityUR.FSTVAGSR.G
579+1 423.2457 844.4769 844.4767 0.280140.17+1Score > 34 indicates identity
Score > 19 indicates homology		UR.TVSGNLVR.T
984  451.7275 901.4405 901.4406 -0.110210.048+1Score > 32 indicates identity
Score > 20 indicates homology		UR.DVHGFATR.F
3935+1 605.3046 1208.5947 1208.5938 0.74070.51+1Score > 34 indicates identity
Score > 16 indicates homology		UK.STYFPADRPR.Q
6269  717.3395 1432.6644 1432.6834 -13.3001+2Score > 33 indicates identity
Score > 13 indicates homology		UR.GVDFTDDPLLQGR.I + Deamidated (NQ)
14863  883.1092 2646.3057 2646.2687 14.0021.1+9Score > 35 indicates identity
Score > 15 indicates homology		UR.HGGPNFEQLPINRPHVPVHNNNR.D + 4 Deamidated (NQ)
16534  1432.1685 2862.3224 2862.3096 4.44000.96+1Score > 35 indicates identity
Score > 13 indicates homology		UR.GAGAHGVFTSYGNYSNITAASFLNEQGK.E + 2 Deamidated (NQ)

-81

AccessionScoreDescription
1gi|154701069|gb|EDO00808.1|27serine protease [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
81.1gi|154701069|gb|EDO00808.1|27555742 (2)1 (1)0.06
serine protease [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154701069|gb|EDO00808.1|
gi|156058540|ref|XP_001595193.1|27555742 (2)1 (1)0.06
serine protease [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095454054|gb|APA11012.1|27555742 (2)1 (1)0.06
hypothetical protein sscle_07g057820 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
81.1gi|154701069|gb|EDO00808.1|27555742 (2)1 (1)0.06serine protease [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154701069|gb|EDO00808.1|
gi|156058540|ref|XP_001595193.1|27555742 (2)1 (1)0.06serine protease [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095454054|gb|APA11012.1|27555742 (2)1 (1)0.06hypothetical protein sscle_07g057820 [Sclerotinia sclerotiorum 1980 UF-70]

-2 peptide matches (1 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
5277+1 664.8142 1327.6137 1327.6520 -28.81260.021+1Score > 32 indicates identity
Score > 22 indicates homology		UK.GVEWAANSHTKK.V + Deamidated (NQ)

-82

AccessionScoreDescription
1gi|347829529|emb|CCD45226.1|27similar to CHL4 family chromosome segregation protein [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
82.1gi|347829529|emb|CCD45226.1|27576662 (1)2 (1)0.06
similar to CHL4 family chromosome segregation protein [Botrytis cinerea T4]
+3 samesets of gi|347829529|emb|CCD45226.1|
gi|154695332|gb|EDN95070.1|27575012 (1)2 (1)0.06
hypothetical protein SS1G_10945 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156043883|ref|XP_001588498.1|27575012 (1)2 (1)0.06
hypothetical protein SS1G_10945 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095455143|gb|APA12099.1|27575012 (1)2 (1)0.06
hypothetical protein sscle_09g068690 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
82.1gi|347829529|emb|CCD45226.1|27576662 (1)2 (1)0.06similar to CHL4 family chromosome segregation protein [Botrytis cinerea T4]
+3 samesets of gi|347829529|emb|CCD45226.1|
gi|154695332|gb|EDN95070.1|27575012 (1)2 (1)0.06hypothetical protein SS1G_10945 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156043883|ref|XP_001588498.1|27575012 (1)2 (1)0.06hypothetical protein SS1G_10945 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095455143|gb|APA12099.1|27575012 (1)2 (1)0.06hypothetical protein sscle_09g068690 [Sclerotinia sclerotiorum 1980 UF-70]

-2 peptide matches (2 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
332  400.7295 799.4444 799.4552 -13.51270.051+1Score > 31 indicates identity
Score > 26 indicates homology		UK.KDTAIPR.F
24240  1647.0947 4938.2624 4938.2771 -2.98051.1+3Score > 34 indicates identity
Score > 18 indicates homology		UR.NQINTAPYLLETDDSASDYAQDLYPPHATLDSLSELYTSFTTQK.G + 2 Deamidated (NQ)

-83

AccessionScoreDescription
1gi|154698344|gb|EDN98082.1|27hypothetical protein SS1G_12939 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
83.1gi|154698344|gb|EDN98082.1|27651584 (1)4 (1)0.05
hypothetical protein SS1G_12939 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154698344|gb|EDN98082.1|
gi|156036500|ref|XP_001586361.1|27651584 (1)4 (1)0.05
hypothetical protein SS1G_12939 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449438|gb|APA06401.1|27647014 (1)4 (1)0.05
hypothetical protein sscle_02g011710 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
83.1gi|154698344|gb|EDN98082.1|27651584 (1)4 (1)0.05hypothetical protein SS1G_12939 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154698344|gb|EDN98082.1|
gi|156036500|ref|XP_001586361.1|27651584 (1)4 (1)0.05hypothetical protein SS1G_12939 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095449438|gb|APA06401.1|27647014 (1)4 (1)0.05hypothetical protein sscle_02g011710 [Sclerotinia sclerotiorum 1980 UF-70]

-4 peptide matches (4 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
807  441.2273 880.4400 880.4654 -28.9113.3+6Score > 31 indicates identity
Score > 18 indicates homology		UR.TVKYNAGK.A + Deamidated (NQ)
2418  538.7830 1075.5515 1075.5510 0.490270.032+1Score > 34 indicates identity
Score > 24 indicates homology		UR.TSGGVVDSNLK.V
4912  646.8261 1291.6375 1291.6707 -25.6131+3Score > 34 indicates identity
Score > 16 indicates homology		U-.MLWIRNSSLR.S + Deamidated (NQ); Oxidation (M)
7442  779.3691 1556.7236 1556.7505 -17.2061+1Score > 33 indicates identity
Score > 19 indicates homology		 K.ALGGTSTINGMTYVR.A + Deamidated (NQ); Oxidation (M)

-84

AccessionScoreDescription
1gi|154693043|gb|EDN92781.1|26hypothetical protein SS1G_08645 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
84.1gi|154693043|gb|EDN92781.1|26523732 (1)1 (1)0.06
hypothetical protein SS1G_08645 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154693043|gb|EDN92781.1|
gi|156049875|ref|XP_001590904.1|26523732 (1)1 (1)0.06
hypothetical protein SS1G_08645 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095456168|gb|APA13123.1|26523732 (1)1 (1)0.06
hypothetical protein sscle_10g078930 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
84.1gi|154693043|gb|EDN92781.1|26523732 (1)1 (1)0.06hypothetical protein SS1G_08645 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154693043|gb|EDN92781.1|
gi|156049875|ref|XP_001590904.1|26523732 (1)1 (1)0.06hypothetical protein SS1G_08645 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095456168|gb|APA13123.1|26523732 (1)1 (1)0.06hypothetical protein sscle_10g078930 [Sclerotinia sclerotiorum 1980 UF-70]

-2 peptide matches (1 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
2574+1 546.7516 1091.4886 1091.4883 0.260260.046+1Score > 31 indicates identity
Score > 26 indicates homology		UK.FQNENTDPK.A

-85

AccessionScoreDescription
1gi|154693434|gb|EDN93172.1|26formate dehydrogenase [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
85.1gi|154693434|gb|EDN93172.1|26481633 (1)2 (1)0.07
formate dehydrogenase [Sclerotinia sclerotiorum 1980 UF-70]
+5 samesets of gi|154693434|gb|EDN93172.1|
gi|156048612|ref|XP_001590273.1|26481633 (1)2 (1)0.07
formate dehydrogenase [Sclerotinia sclerotiorum 1980 UF-70]
gi|347841449|emb|CCD56021.1|26482053 (1)2 (1)0.07
similar to NAD-dependent formate dehydrogenase [Botrytis cinerea T4]
gi|406863832|gb|EKD16879.1|26863943 (1)2 (1)0.04
formate dehydrogenase [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
gi|597580361|ref|XP_007293237.1|26863943 (1)2 (1)0.04
formate dehydrogenase [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
gi|1095458429|gb|APA15380.1|26411113 (1)2 (1)0.08
hypothetical protein sscle_14g101500 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
85.1gi|154693434|gb|EDN93172.1|26481633 (1)2 (1)0.07formate dehydrogenase [Sclerotinia sclerotiorum 1980 UF-70]
+5 samesets of gi|154693434|gb|EDN93172.1|
gi|156048612|ref|XP_001590273.1|26481633 (1)2 (1)0.07formate dehydrogenase [Sclerotinia sclerotiorum 1980 UF-70]
gi|347841449|emb|CCD56021.1|26482053 (1)2 (1)0.07similar to NAD-dependent formate dehydrogenase [Botrytis cinerea T4]
gi|406863832|gb|EKD16879.1|26863943 (1)2 (1)0.04formate dehydrogenase [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
gi|597580361|ref|XP_007293237.1|26863943 (1)2 (1)0.04formate dehydrogenase [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
gi|1095458429|gb|APA15380.1|26411113 (1)2 (1)0.08hypothetical protein sscle_14g101500 [Sclerotinia sclerotiorum 1980 UF-70]

-3 peptide matches (2 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
552+1 421.7585 841.5025 841.5134 -13.0172+10Score > 30 indicates identity
Score > 23 indicates homology		UR.IGERVLR.R
669  429.2635 856.5124 856.5131 -0.760260.045+1Score > 32 indicates identity
Score > 25 indicates homology		UK.VVGTVAVGR.I

-86

AccessionScoreDescription
1gi|154694870|gb|EDN94608.1|26hypothetical protein SS1G_10482 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
86.1gi|154694870|gb|EDN94608.1|26381282 (1)1 (1)0.09
hypothetical protein SS1G_10482 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154694870|gb|EDN94608.1|
gi|156044756|ref|XP_001588934.1|26381282 (1)1 (1)0.09
hypothetical protein SS1G_10482 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095459324|gb|APA16273.1|26381282 (1)1 (1)0.09
hypothetical protein sscle_16g110430 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
86.1gi|154694870|gb|EDN94608.1|26381282 (1)1 (1)0.09hypothetical protein SS1G_10482 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154694870|gb|EDN94608.1|
gi|156044756|ref|XP_001588934.1|26381282 (1)1 (1)0.09hypothetical protein SS1G_10482 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095459324|gb|APA16273.1|26381282 (1)1 (1)0.09hypothetical protein sscle_16g110430 [Sclerotinia sclerotiorum 1980 UF-70]

-2 peptide matches (1 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
372+1 405.7452 809.4759 809.4759 -0.0670260.0091+1Score > 26 indicates identity
Score > 18 indicates homology		UR.TPPNLIR.A

-87

AccessionScoreDescription
1gi|347830192|emb|CCD45889.1|25glycoside hydrolase family 27 protein [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
87.1gi|347830192|emb|CCD45889.1|25591014 (1)3 (1)0.06
glycoside hydrolase family 27 protein [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
87.1gi|347830192|emb|CCD45889.1|25591014 (1)3 (1)0.06glycoside hydrolase family 27 protein [Botrytis cinerea T4]

-4 peptide matches (3 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
459+1 414.7686 827.5225 827.5229 -0.390250.044+1Score > 29 indicates identity
Score > 24 indicates homology		UR.LLTVINR.G
1224  468.2505 934.4865 934.4872 -0.760118.2+4Score > 33 indicates identity
Score > 33 indicates homology		 K.GLLAAGYNR.L + Deamidated (NQ)
21794  935.1849 3736.7104 3736.7427 -8.64210.92+1Score > 35 indicates identity
Score > 13 indicates homology		UK.GLLAAGYNRLNLDDCWSQGSREPNGSLLWNTEK.F + 3 Deamidated (NQ)

-88

AccessionScoreDescription
1gi|347837155|emb|CCD51727.1|25similar to MFS multidrug transporter [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
88.1gi|347837155|emb|CCD51727.1|25547112 (1)1 (1)0.06
similar to MFS multidrug transporter [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
88.1gi|347837155|emb|CCD51727.1|25547112 (1)1 (1)0.06similar to MFS multidrug transporter [Botrytis cinerea T4]

-2 peptide matches (1 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
462+1 414.7690 827.5235 827.5229 0.700250.037+1Score > 29 indicates identity
Score > 24 indicates homology		UR.IGTVGILR.A

-89

AccessionScoreDescription
1gi|347835242|emb|CCD49814.1|25hypothetical protein BofuT4_P095220.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
89.1gi|347835242|emb|CCD49814.1|25584962 (1)1 (1)0.06
hypothetical protein BofuT4_P095220.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
89.1gi|347835242|emb|CCD49814.1|25584962 (1)1 (1)0.06hypothetical protein BofuT4_P095220.1 [Botrytis cinerea T4]

-2 peptide matches (1 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
105+1 371.2516 740.4886 740.5021 -18.21250.029+1Score > 22 indicates identityUR.RILLAR.L

-90

AccessionScoreDescription
1gi|154695175|gb|EDN94913.1|25hypothetical protein SS1G_10788 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
90.1gi|154695175|gb|EDN94913.1|251121613 (1)3 (1)0.03
hypothetical protein SS1G_10788 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154695175|gb|EDN94913.1|
gi|156043569|ref|XP_001588341.1|251121613 (1)3 (1)0.03
hypothetical protein SS1G_10788 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095455264|gb|APA12220.1|251110853 (1)3 (1)0.03
hypothetical protein sscle_09g069900 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347829353|emb|CCD45050.1|251111272 (1)2 (1)0.03
similar to oxysterol-binding protein [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
90.1gi|154695175|gb|EDN94913.1|251121613 (1)3 (1)0.03hypothetical protein SS1G_10788 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154695175|gb|EDN94913.1|
gi|156043569|ref|XP_001588341.1|251121613 (1)3 (1)0.03hypothetical protein SS1G_10788 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095455264|gb|APA12220.1|251110853 (1)3 (1)0.03hypothetical protein sscle_09g069900 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347829353|emb|CCD45050.1|251111272 (1)2 (1)0.03similar to oxysterol-binding protein [Botrytis cinerea T4]

-3 peptide matches (3 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
251  392.7192 783.4238 783.4351 -14.4091.2+2Score > 27 indicates identity
Score > 23 indicates homology		 R.LRPDQR.A
5876  695.3306 1388.6466 1388.6428 2.730250.018+1Score > 33 indicates identity
Score > 20 indicates homology		U-.MAGMEQLEIHSK.S + Oxidation (M)
6164  474.5683 1420.6831 1420.6681 10.5101.1+2Score > 34 indicates identity
Score > 13 indicates homology		UR.NDSSTAQEQLKAK.G + 2 Deamidated (NQ)

-91

AccessionScoreDescription
1gi|347828924|emb|CCD44621.1|25hypothetical protein BofuT4_P055220.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
91.1gi|347828924|emb|CCD44621.1|251401737 (1)5 (1)0.02
hypothetical protein BofuT4_P055220.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
91.1gi|347828924|emb|CCD44621.1|251401737 (1)5 (1)0.02hypothetical protein BofuT4_P055220.1 [Botrytis cinerea T4]

-7 peptide matches (7 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
770  436.7453 871.4760 871.5014 -29.20130.32+1Score > 33 indicates identity
Score > 21 indicates homology		UK.QLEILQK.S + Deamidated (NQ)
3175  572.3174 1142.6202 1142.6156 4.06291.1+2Score > 33 indicates identity
Score > 22 indicates homology		UR.RQLNQQRAK.A + 2 Deamidated (NQ)
3229  575.7993 1149.5840 1149.5699 12.2161.5+6Score > 34 indicates identity
Score > 20 indicates homology		 K.EAMAKVDAATK.D + Oxidation (M)
5165  658.3696 1314.7246 1314.7394 -11.31250.032+1Score > 33 indicates identity
Score > 22 indicates homology		UR.ETILKENVELK.K
5166  439.2494 1314.7263 1314.7394 -10.0141+1Score > 33 indicates identity
Score > 17 indicates homology		UR.ETILKENVELK.K
5185  658.8622 1315.7098 1315.7235 -10.4143.8+8Score > 34 indicates identity
Score > 23 indicates homology		UR.ETILKENVELK.K + Deamidated (NQ)
17243  975.8124 2924.4155 2924.4558 -13.8200.96+1Score > 35 indicates identity
Score > 13 indicates homology		UR.QLNQQRAKASAQTIQMLMGFMILQR.A + 4 Deamidated (NQ); Oxidation (M)

-92

AccessionScoreDescription
1gi|154697379|gb|EDN97117.1|25hypothetical protein SS1G_02045 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
92.1gi|154697379|gb|EDN97117.1|2598646 (2)3 (1)0.35
hypothetical protein SS1G_02045 [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154697379|gb|EDN97117.1|
gi|156063854|ref|XP_001597849.1|2598646 (2)3 (1)0.35
hypothetical protein SS1G_02045 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
92.1gi|154697379|gb|EDN97117.1|2598646 (2)3 (1)0.35hypothetical protein SS1G_02045 [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154697379|gb|EDN97117.1|
gi|156063854|ref|XP_001597849.1|2598646 (2)3 (1)0.35hypothetical protein SS1G_02045 [Sclerotinia sclerotiorum 1980 UF-70]

-6 peptide matches (3 non-duplicate, 3 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
1434  481.7563 961.4981 961.4828 15.8133+9Score > 34 indicates identity
Score > 21 indicates homology		 M.QTTSKEAR.I + Acetyl (Protein N-term)
1466  483.7779 965.5412 965.5559 -15.3124.1+6Score > 30 indicates identity
Score > 21 indicates homology		 K.VGKLWAHR.F
4727+3 639.3592 1276.7039 1276.6914 9.820270.065+1Score > 32 indicates identity
Score > 28 indicates homology		UR.INLAIEAIYEK.G + Deamidated (NQ)

-93

AccessionScoreDescription
1gi|154701688|gb|EDO01427.1|24predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
93.1gi|154701688|gb|EDO01427.1|24782128 (1)3 (1)0.04
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154701688|gb|EDO01427.1|
gi|156059778|ref|XP_001595812.1|24782128 (1)3 (1)0.04
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095455532|gb|APA12488.1|24782128 (1)3 (1)0.04
hypothetical protein sscle_09g072580 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
93.1gi|154701688|gb|EDO01427.1|24782128 (1)3 (1)0.04predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154701688|gb|EDO01427.1|
gi|156059778|ref|XP_001595812.1|24782128 (1)3 (1)0.04predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095455532|gb|APA12488.1|24782128 (1)3 (1)0.04hypothetical protein sscle_09g072580 [Sclerotinia sclerotiorum 1980 UF-70]

-8 peptide matches (3 non-duplicate, 5 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
509+5 418.7527 835.4909 835.4916 -0.840240.023+1Score > 27 indicates identity
Score > 20 indicates homology		UR.VPAPVTPR.L
713  433.2555 864.4964 864.4705 30.00131.7+2Score > 29 indicates identity
Score > 28 indicates homology		UK.ISIQYNK.T
16245  945.4890 2833.4452 2833.3758 24.5121+1Score > 35 indicates identity
Score > 14 indicates homology		UK.WPPLTSENSLYHPIQGRGDPMPWR.K

-94

AccessionScoreDescription
1gi|154693594|gb|EDN93332.1|24predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
94.1gi|154693594|gb|EDN93332.1|24137471 (1)1 (1)0.25
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154693594|gb|EDN93332.1|
gi|156045844|ref|XP_001589477.1|24137471 (1)1 (1)0.25
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
94.1gi|154693594|gb|EDN93332.1|24137471 (1)1 (1)0.25predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154693594|gb|EDN93332.1|
gi|156045844|ref|XP_001589477.1|24137471 (1)1 (1)0.25predicted protein [Sclerotinia sclerotiorum 1980 UF-70]

-1 peptide matches (1 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
8413  838.9204 1675.8263 1675.8199 3.791240.0072+1Score > 35 indicates identity
Score > 15 indicates homology		UR.MGSQNPTTIKNQVNK.L + Deamidated (NQ); Oxidation (M)

-95

AccessionScoreDescription
1gi|205829274|sp|A6S9N4.1|PAN1_BOTFB23RecName: Full=Actin cytoskeleton-regulatory complex protein pan1
ScoreMassMatchesSequencesemPAI
95.1gi|205829274|sp|A6S9N4.1|PAN1_BOTFB2315586110 (1)4 (1)0.02
RecName: Full=Actin cytoskeleton-regulatory complex protein pan1
+1 sameset of gi|205829274|sp|A6S9N4.1|PAN1_BOTFB
gi|347841674|emb|CCD56246.1|2315584310 (1)4 (1)0.02
hypothetical protein BofuT4_P148560.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
95.1gi|205829274|sp|A6S9N4.1|PAN1_BOTFB2315586110 (1)4 (1)0.02RecName: Full=Actin cytoskeleton-regulatory complex protein pan1
+1 sameset of gi|205829274|sp|A6S9N4.1|PAN1_BOTFB
gi|347841674|emb|CCD56246.1|2315584310 (1)4 (1)0.02hypothetical protein BofuT4_P148560.1 [Botrytis cinerea T4]

-10 peptide matches (4 non-duplicate, 6 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
403  408.7505 815.4865 815.4726 17.1282.3+7Score > 32 indicates identity
Score > 24 indicates homology		 R.VRRTER.S
2396  537.2827 1072.5509 1072.5512 -0.351230.051+1Score > 33 indicates identity
Score > 23 indicates homology		UR.QEAELAKER.E
3229+2 575.7993 1149.5840 1149.6029 -16.5171.1+2Score > 34 indicates identity
Score > 20 indicates homology		UR.AAYIKQQAEK.R + Deamidated (NQ)
3495+4 586.2965 1170.5785 1170.6105 -27.4180.2+1Score > 32 indicates identity
Score > 14 indicates homology		 K.QQEARLAAQR.A + Deamidated (NQ)

-96

AccessionScoreDescription
1gi|8515841|gb|AAF76202.1|AF271387_123aspartyl protease [Sclerotinia sclerotiorum]
ScoreMassMatchesSequencesemPAI
96.1gi|8515841|gb|AAF76202.1|AF271387_123454174 (2)3 (2)0.15
aspartyl protease [Sclerotinia sclerotiorum]
+7 samesets of gi|8515841|gb|AAF76202.1|AF271387_1
gi|154701416|gb|EDO01155.1|23448893 (2)2 (2)0.15
aspartyl protease [Sclerotinia sclerotiorum 1980 UF-70]
gi|156059234|ref|XP_001595540.1|23448893 (2)2 (2)0.15
aspartyl protease [Sclerotinia sclerotiorum 1980 UF-70]
gi|374094078|gb|AEY84361.1|23368503 (2)2 (2)0.19
aspartyl protease, partial [Sclerotinia sclerotiorum]
gi|374094080|gb|AEY84362.1|23368503 (2)2 (2)0.19
aspartyl protease, partial [Sclerotinia sclerotiorum]
gi|374094082|gb|AEY84363.1|23368503 (2)2 (2)0.19
aspartyl protease, partial [Sclerotinia sclerotiorum]
gi|374094084|gb|AEY84364.1|23368503 (2)2 (2)0.19
aspartyl protease, partial [Sclerotinia sclerotiorum]
gi|1095455745|gb|APA12701.1|23448893 (2)2 (2)0.15
hypothetical protein sscle_09g074710 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
96.1gi|8515841|gb|AAF76202.1|AF271387_123454174 (2)3 (2)0.15aspartyl protease [Sclerotinia sclerotiorum]
+7 samesets of gi|8515841|gb|AAF76202.1|AF271387_1
gi|154701416|gb|EDO01155.1|23448893 (2)2 (2)0.15aspartyl protease [Sclerotinia sclerotiorum 1980 UF-70]
gi|156059234|ref|XP_001595540.1|23448893 (2)2 (2)0.15aspartyl protease [Sclerotinia sclerotiorum 1980 UF-70]
gi|374094078|gb|AEY84361.1|23368503 (2)2 (2)0.19aspartyl protease, partial [Sclerotinia sclerotiorum]
gi|374094080|gb|AEY84362.1|23368503 (2)2 (2)0.19aspartyl protease, partial [Sclerotinia sclerotiorum]
gi|374094082|gb|AEY84363.1|23368503 (2)2 (2)0.19aspartyl protease, partial [Sclerotinia sclerotiorum]
gi|374094084|gb|AEY84364.1|23368503 (2)2 (2)0.19aspartyl protease, partial [Sclerotinia sclerotiorum]
gi|1095455745|gb|APA12701.1|23448893 (2)2 (2)0.15hypothetical protein sscle_09g074710 [Sclerotinia sclerotiorum 1980 UF-70]

-4 peptide matches (4 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
2984  563.8333 1125.6519 1125.6506 1.210220.047+1Score > 29 indicates identity
Score > 21 indicates homology		UK.LNTVKPAQQK.T
13411  1182.5546 2363.0946 2363.0926 0.830101+1Score > 35 indicates identity
Score > 23 indicates homology		UK.TFFDNAMSQGLAMPVFTADLR.K + 2 Oxidation (M)
13412  788.7092 2363.1057 2363.0926 5.530190.021+1Score > 35 indicates identity
Score > 14 indicates homology		UK.TFFDNAMSQGLAMPVFTADLR.K + 2 Oxidation (M)
23337  1514.3477 4540.0212 4539.9952 5.71021+3Score > 33 indicates identity
Score > 14 indicates homology		UK.MMQGANWSISYGDGSGAAGNVGTDTVNIGGATVTGQAIEMATAVSR.S + 3 Deamidated (NQ); Dioxidation (W); 2 Oxidation (M)

-97

AccessionScoreDescription
1gi|347837413|emb|CCD51985.1|23hypothetical protein BofuT4_P081440.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
97.1gi|347837413|emb|CCD51985.1|23740203 (1)2 (1)0.04
hypothetical protein BofuT4_P081440.1 [Botrytis cinerea T4]
+3 samesets of gi|347837413|emb|CCD51985.1|
gi|154692815|gb|EDN92553.1|23741722 (1)2 (1)0.04
hypothetical protein SS1G_08416 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156049419|ref|XP_001590676.1|23741722 (1)2 (1)0.04
hypothetical protein SS1G_08416 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095455979|gb|APA12934.1|23729152 (1)2 (1)0.05
hypothetical protein sscle_10g077040 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
97.1gi|347837413|emb|CCD51985.1|23740203 (1)2 (1)0.04hypothetical protein BofuT4_P081440.1 [Botrytis cinerea T4]
+3 samesets of gi|347837413|emb|CCD51985.1|
gi|154692815|gb|EDN92553.1|23741722 (1)2 (1)0.04hypothetical protein SS1G_08416 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156049419|ref|XP_001590676.1|23741722 (1)2 (1)0.04hypothetical protein SS1G_08416 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095455979|gb|APA12934.1|23729152 (1)2 (1)0.05hypothetical protein sscle_10g077040 [Sclerotinia sclerotiorum 1980 UF-70]

-3 peptide matches (2 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
4596  632.3330 1262.6515 1262.6731 -17.20230.015+1Score > 34 indicates identity
Score > 17 indicates homology		UK.GEAVVPHQALSR.V
5562+1 679.3596 1356.7047 1356.7249 -14.9161.5+7Score > 33 indicates identity
Score > 20 indicates homology		UR.GAQEVVQRVLEK.L + 2 Deamidated (NQ)

-98

AccessionScoreDescription
1gi|154701812|gb|EDO01551.1|22hypothetical protein SS1G_04026 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
98.1gi|154701812|gb|EDO01551.1|22145983 (1)1 (1)0.23
hypothetical protein SS1G_04026 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154701812|gb|EDO01551.1|
gi|156056591|ref|XP_001594219.1|22145983 (1)1 (1)0.23
hypothetical protein SS1G_04026 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095450275|gb|APA07238.1|22145983 (1)1 (1)0.23
hypothetical protein sscle_02g020080 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
98.1gi|154701812|gb|EDO01551.1|22145983 (1)1 (1)0.23hypothetical protein SS1G_04026 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154701812|gb|EDO01551.1|
gi|156056591|ref|XP_001594219.1|22145983 (1)1 (1)0.23hypothetical protein SS1G_04026 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095450275|gb|APA07238.1|22145983 (1)1 (1)0.23hypothetical protein sscle_02g020080 [Sclerotinia sclerotiorum 1980 UF-70]

-3 peptide matches (1 non-duplicate, 2 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
5489+2 674.8296 1347.6446 1347.6684 -17.61220.053+1Score > 34 indicates identity
Score > 22 indicates homology		UK.YHPAGDPRNPPK.E

-99

AccessionScoreDescription
1gi|189082538|sp|A6RIS1.2|MPH1_BOTFB22RecName: Full=ATP-dependent DNA helicase MPH1; AltName: Full=FANCM-like protein 1
ScoreMassMatchesSequencesemPAI
99.1gi|189082538|sp|A6RIS1.2|MPH1_BOTFB221371884 (1)4 (1)0.02
RecName: Full=ATP-dependent DNA helicase MPH1; AltName: Full=FANCM-like protein 1
+1 sameset of gi|189082538|sp|A6RIS1.2|MPH1_BOTFB
gi|347829953|emb|CCD45650.1|221371884 (1)4 (1)0.02
similar to gi|189082538|sp|A6RIS1.2|MPH1_BOTFB RecName: Full=ATP-dependent DNA helicase mph1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
99.1gi|189082538|sp|A6RIS1.2|MPH1_BOTFB221371884 (1)4 (1)0.02RecName: Full=ATP-dependent DNA helicase MPH1; AltName: Full=FANCM-like protein 1
+1 sameset of gi|189082538|sp|A6RIS1.2|MPH1_BOTFB
gi|347829953|emb|CCD45650.1|221371884 (1)4 (1)0.02similar to gi|189082538|sp|A6RIS1.2|MPH1_BOTFB RecName: Full=ATP-dependent DNA helicase mph1 [Botrytis cinerea T4]

-4 peptide matches (4 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
157  380.2216 758.4287 758.4286 0.0700290.19+1Score > 34 indicates identity K.QLETIR.K
328  399.7690 797.5233 797.5235 -0.21227.6+10Score > 24 indicates identity
Score > 23 indicates homology		UK.ARKKPAK.K
2486  542.2886 1082.5627 1082.5356 25.0015.4+7Score > 31 indicates identity
Score > 21 indicates homology		UK.LNGNVAGPPSR.I + 2 Deamidated (NQ)
7854  806.3768 1610.7391 1610.7545 -9.551220.012+1Score > 33 indicates identity
Score > 15 indicates homology		UK.TWMASGAGKSANMGVK.G + Oxidation (M)

-100

AccessionScoreDescription
1gi|154702860|gb|EDO02599.1|22predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
100.1gi|154702860|gb|EDO02599.1|2262194 (1)2 (1)0.58
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154702860|gb|EDO02599.1|
gi|156055448|ref|XP_001593648.1|2262194 (1)2 (1)0.58
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
100.1gi|154702860|gb|EDO02599.1|2262194 (1)2 (1)0.58predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154702860|gb|EDO02599.1|
gi|156055448|ref|XP_001593648.1|2262194 (1)2 (1)0.58predicted protein [Sclerotinia sclerotiorum 1980 UF-70]

-4 peptide matches (2 non-duplicate, 2 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
136+1 377.1894 752.3642 752.3752 -14.5170.27+1Score > 30 indicates identity
Score > 14 indicates homology		UK.QRYMR.T
2185+1 526.7744 1051.5341 1051.5596 -24.22220.022+1Score > 32 indicates identity
Score > 18 indicates homology		UR.IGKQRYMR.T + Deamidated (NQ)

-101

AccessionScoreDescription
1gi|347830803|emb|CCD46500.1|22similar to transcription factor Zn, C2H2 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
101.1gi|347830803|emb|CCD46500.1|22474633 (1)2 (1)0.07
similar to transcription factor Zn, C2H2 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
101.1gi|347830803|emb|CCD46500.1|22474633 (1)2 (1)0.07similar to transcription factor Zn, C2H2 [Botrytis cinerea T4]

-3 peptide matches (2 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
1836  507.2307 1012.4467 1012.4760 -28.91220.024+1Score > 29 indicates identity
Score > 18 indicates homology		UK.TCTKSFNR.K
4427+1 625.8223 1249.6300 1249.6527 -18.2251.6+7Score > 34 indicates identity
Score > 20 indicates homology		 K.SFNRKSDLQR.H

-102

AccessionScoreDescription
1gi|154699920|gb|EDN99658.1|22hypothetical protein SS1G_02516 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
102.1gi|154699920|gb|EDN99658.1|22172083 (1)2 (1)0.20
hypothetical protein SS1G_02516 [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154699920|gb|EDN99658.1|
gi|156060747|ref|XP_001596296.1|22172083 (1)2 (1)0.20
hypothetical protein SS1G_02516 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
102.1gi|154699920|gb|EDN99658.1|22172083 (1)2 (1)0.20hypothetical protein SS1G_02516 [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154699920|gb|EDN99658.1|
gi|156060747|ref|XP_001596296.1|22172083 (1)2 (1)0.20hypothetical protein SS1G_02516 [Sclerotinia sclerotiorum 1980 UF-70]

-3 peptide matches (2 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
1707+1 497.7654 993.5161 993.4913 25.01260.082+1Score > 32 indicates identity
Score > 28 indicates homology		UK.SEAGLKSMR.A + Oxidation (M)
3879  603.3091 1204.6036 1204.6346 -25.7244+6Score > 34 indicates identity
Score > 22 indicates homology		UK.SEAGLKSMRAR.A

-103

AccessionScoreDescription
1gi|347839278|emb|CCD53850.1|21similar to aspartic protease precursor (secreted protein) [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
103.1gi|347839278|emb|CCD53850.1|21398204 (1)1 (1)0.08
similar to aspartic protease precursor (secreted protein) [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
103.1gi|347839278|emb|CCD53850.1|21398204 (1)1 (1)0.08similar to aspartic protease precursor (secreted protein) [Botrytis cinerea T4]

-4 peptide matches (1 non-duplicate, 3 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
324+3 399.7572 797.4999 797.5011 -1.450210.042+1Score > 26 indicates identity
Score > 20 indicates homology		UK.SAVLPLAK.H

-104

AccessionScoreDescription
1gi|1095450321|gb|APA07284.1|21hypothetical protein sscle_02g020540 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
104.1gi|1095450321|gb|APA07284.1|21424327 (1)4 (1)0.08
hypothetical protein sscle_02g020540 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|1095450321|gb|APA07284.1|
gi|154698573|gb|EDN98311.1|21327595 (1)2 (1)0.10
hypothetical protein SS1G_13169 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156035929|ref|XP_001586076.1|21327595 (1)2 (1)0.10
hypothetical protein SS1G_13169 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347841961|emb|CCD56533.1|21429284 (1)1 (1)0.08
similar to SET domain-containing protein [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
104.1gi|1095450321|gb|APA07284.1|21424327 (1)4 (1)0.08hypothetical protein sscle_02g020540 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|1095450321|gb|APA07284.1|
gi|154698573|gb|EDN98311.1|21327595 (1)2 (1)0.10hypothetical protein SS1G_13169 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156035929|ref|XP_001586076.1|21327595 (1)2 (1)0.10hypothetical protein SS1G_13169 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347841961|emb|CCD56533.1|21429284 (1)1 (1)0.08similar to SET domain-containing protein [Botrytis cinerea T4]

-7 peptide matches (4 non-duplicate, 3 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
848  443.2432 884.4718 884.4967 -28.2139.3+8Score > 29 indicates identity
Score > 25 indicates homology		UK.SSKLQPPK.E + Deamidated (NQ)
1518  486.7776 971.5406 971.5261 14.9151.1+2Score > 33 indicates identity
Score > 18 indicates homology		UK.TRAGLNGQR.D
4432+3 625.8409 1249.6673 1249.6554 9.550250.089+1Score > 33 indicates identity
Score > 27 indicates homology		UR.AGYTLTASQPIK.E + Deamidated (NQ)
5280  664.8812 1327.7479 1327.7320 12.0212.9+7Score > 32 indicates identity
Score > 18 indicates homology		UR.INKTRAGLNGQR.D + Deamidated (NQ)

-105

AccessionScoreDescription
1gi|347829515|emb|CCD45212.1|19similar to serine/threonine-protein kinase ssp1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
105.1gi|347829515|emb|CCD45212.1|191352758 (1)4 (1)0.02
similar to serine/threonine-protein kinase ssp1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
105.1gi|347829515|emb|CCD45212.1|191352758 (1)4 (1)0.02similar to serine/threonine-protein kinase ssp1 [Botrytis cinerea T4]

-8 peptide matches (4 non-duplicate, 4 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
275  395.2268 788.4391 788.4253 17.5241.1+2Score > 33 indicates identity
Score > 17 indicates homology		UK.GEGSRKR.A
720+4 434.2556 866.4966 866.4722 28.10190.033+1Score > 28 indicates identity
Score > 17 indicates homology		UK.LAAVGSHGR.R
1188  465.7482 929.4818 929.5043 -24.1157.1+6Score > 33 indicates identity
Score > 26 indicates homology		UR.ATSRAPTAR.S
2377  358.2081 1071.6026 1071.5746 26.1111.7+5Score > 33 indicates identity
Score > 16 indicates homology		 R.MLIKDPAER.I

-106

AccessionScoreDescription
1gi|154701425|gb|EDO01164.1|19predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
106.1gi|154701425|gb|EDO01164.1|1976464 (1)1 (1)0.46
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154701425|gb|EDO01164.1|
gi|156059252|ref|XP_001595549.1|1976464 (1)1 (1)0.46
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
106.1gi|154701425|gb|EDO01164.1|1976464 (1)1 (1)0.46predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154701425|gb|EDO01164.1|
gi|156059252|ref|XP_001595549.1|1976464 (1)1 (1)0.46predicted protein [Sclerotinia sclerotiorum 1980 UF-70]

-4 peptide matches (1 non-duplicate, 3 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
5589+3 680.3554 1358.6961 1358.7228 -19.61190.019+1Score > 34 indicates identity
Score > 14 indicates homology		U-.MVILQVKNDTR.E + Acetyl (Protein N-term); Deamidated (NQ)

-107

AccessionScoreDescription
1gi|347840830|emb|CCD55402.1|19similar to NADH-cytochrome b5 reductase [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
107.1gi|347840830|emb|CCD55402.1|19341661 (1)1 (1)0.10
similar to NADH-cytochrome b5 reductase [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
107.1gi|347840830|emb|CCD55402.1|19341661 (1)1 (1)0.10similar to NADH-cytochrome b5 reductase [Botrytis cinerea T4]

-1 peptide matches (1 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
5514  676.8569 1351.6992 1351.6806 13.81190.056+1Score > 33 indicates identity
Score > 19 indicates homology		U-.MSTAPANKFLSK.A + Acetyl (Protein N-term); Oxidation (M)

-108

AccessionScoreDescription
1gi|1095450298|gb|APA07261.1|18hypothetical protein sscle_02g020310 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
108.1gi|1095450298|gb|APA07261.1|18872669 (1)6 (1)0.04
hypothetical protein sscle_02g020310 [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|1095450298|gb|APA07261.1|
gi|347840168|emb|CCD54740.1|18872938 (1)5 (1)0.04
similar to anaphase-promoting complex subunit Apc5 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
108.1gi|1095450298|gb|APA07261.1|18872669 (1)6 (1)0.04hypothetical protein sscle_02g020310 [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|1095450298|gb|APA07261.1|
gi|347840168|emb|CCD54740.1|18872938 (1)5 (1)0.04similar to anaphase-promoting complex subunit Apc5 [Botrytis cinerea T4]

-9 peptide matches (6 non-duplicate, 3 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
799  440.2386 878.4626 878.4498 14.6061.9+3Score > 32 indicates identity
Score > 21 indicates homology		 R.ADFGAALSK.L
3768+1 598.7989 1195.5833 1195.5763 5.891141.2+2Score > 33 indicates identity
Score > 27 indicates homology		 K.KAMVMMAVGDK.T + Oxidation (M)
6932  753.3713 1504.7280 1504.7521 -16.0111.1+6Score > 34 indicates identity
Score > 14 indicates homology		 K.LEGLDSNSLRSWK.A + Deamidated (NQ)
6999+1 757.9162 1513.8178 1513.8463 -18.82180.043+1Score > 33 indicates identity
Score > 17 indicates homology		UR.LNNLLAKSREDIK.K + Deamidated (NQ)
11988+1 1074.4508 2146.8871 2146.9268 -18.5111+1Score > 29 indicates identity
Score > 13 indicates homology		 K.GMKSMMGPQTAMQSSLWGR.L + Dioxidation (W); 2 Oxidation (M)
23746  1204.6296 4814.4895 4814.5437 -11.3211+8Score > 32 indicates identity
Score > 13 indicates homology		 R.AASIAWRARLMPALWAAMAAVANILVALSEFQAACQIVIAILPR.A + Deamidated (NQ); 2 Dioxidation (W); 2 Oxidation (M)

-109

AccessionScoreDescription
1gi|154703296|gb|EDO03035.1|18hypothetical protein SS1G_05513 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
109.1gi|154703296|gb|EDO03035.1|18691874 (1)2 (1)0.05
hypothetical protein SS1G_05513 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154703296|gb|EDO03035.1|
gi|156056320|ref|XP_001594084.1|18691874 (1)2 (1)0.05
hypothetical protein SS1G_05513 [Sclerotinia sclerotiorum 1980 UF-70]
gi|171704394|sp|A7EJL9.1|LKHA4_SCLS118691874 (1)2 (1)0.05
RecName: Full=Leukotriene A-4 hydrolase homolog; Short=LTA-4 hydrolase; AltName: Full=Leukotriene A(4) hydrolase
gi|1095454999|gb|APA11956.1|18691874 (1)2 (1)0.05
hypothetical protein sscle_08g067260 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
109.1gi|154703296|gb|EDO03035.1|18691874 (1)2 (1)0.05hypothetical protein SS1G_05513 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154703296|gb|EDO03035.1|
gi|156056320|ref|XP_001594084.1|18691874 (1)2 (1)0.05hypothetical protein SS1G_05513 [Sclerotinia sclerotiorum 1980 UF-70]
gi|171704394|sp|A7EJL9.1|LKHA4_SCLS118691874 (1)2 (1)0.05RecName: Full=Leukotriene A-4 hydrolase homolog; Short=LTA-4 hydrolase; AltName: Full=Leukotriene A(4) hydrolase
gi|1095454999|gb|APA11956.1|18691874 (1)2 (1)0.05hypothetical protein sscle_08g067260 [Sclerotinia sclerotiorum 1980 UF-70]

-4 peptide matches (2 non-duplicate, 2 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
1660+1 494.7727 987.5309 987.5237 7.37181.2+4Score > 34 indicates identity
Score > 21 indicates homology		UR.EQVEKDLK.E
4079+1 611.7908 1221.5671 1221.5666 0.410180.025+1Score > 33 indicates identity
Score > 14 indicates homology		UK.LFGEDHEFTK.L

-110

AccessionScoreDescription
1gi|347441684|emb|CCD34605.1|18similar to N-alpha-acetyltransferase 15 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
110.1gi|347441684|emb|CCD34605.1|18846004 (1)3 (1)0.04
similar to N-alpha-acetyltransferase 15 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
110.1gi|347441684|emb|CCD34605.1|18846004 (1)3 (1)0.04similar to N-alpha-acetyltransferase 15 [Botrytis cinerea T4]

-4 peptide matches (3 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
682  430.2388 858.4630 858.4671 -4.742811+7Score > 34 indicates identity
Score > 31 indicates homology		 K.ARKEAER.L
4114  409.2397 1224.6972 1224.7190 -17.7211.1+2Score > 29 indicates identity
Score > 14 indicates homology		 K.AADQILKKNPK.H
9231+1 891.9085 1781.8023 1781.8175 -8.511180.03+1Score > 33 indicates identity
Score > 15 indicates homology		UK.CLMAASAIDKENESVK.E + Deamidated (NQ); Oxidation (M)

-111

AccessionScoreDescription
1gi|347831843|emb|CCD47540.1|18similar to NRPS-like enzyme [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
111.1gi|347831843|emb|CCD47540.1|181225307 (1)4 (1)0.03
similar to NRPS-like enzyme [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
111.1gi|347831843|emb|CCD47540.1|181225307 (1)4 (1)0.03similar to NRPS-like enzyme [Botrytis cinerea T4]

-7 peptide matches (4 non-duplicate, 3 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
2085  521.3116 1040.6087 1040.6342 -24.5121+2Score > 29 indicates identity
Score > 14 indicates homology		UK.IQVKVNIAR.V + Deamidated (NQ)
3884+1 603.3138 1204.6131 1204.6452 -26.61180.037+1Score > 34 indicates identity
Score > 16 indicates homology		UR.SRDLLTEFPK.D
15736+1 926.4822 2776.4249 2776.3456 28.5111+3Score > 34 indicates identity
Score > 14 indicates homology		UK.TFPDLQEYQTRDLFVPHSSKPNR.W + 2 Deamidated (NQ)
16207+1 945.1604 2832.4594 2832.4129 16.4221.1+7Score > 34 indicates identity
Score > 15 indicates homology		UR.RVTYKDFANAINGVAWCLHGNLGAGK.E + Deamidated (NQ)

-112

AccessionScoreDescription
1gi|154695791|gb|EDN95529.1|17hypothetical protein SS1G_11407 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
112.1gi|154695791|gb|EDN95529.1|17365492 (1)2 (1)0.09
hypothetical protein SS1G_11407 [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154695791|gb|EDN95529.1|
gi|156040858|ref|XP_001587415.1|17365492 (1)2 (1)0.09
hypothetical protein SS1G_11407 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
112.1gi|154695791|gb|EDN95529.1|17365492 (1)2 (1)0.09hypothetical protein SS1G_11407 [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154695791|gb|EDN95529.1|
gi|156040858|ref|XP_001587415.1|17365492 (1)2 (1)0.09hypothetical protein SS1G_11407 [Sclerotinia sclerotiorum 1980 UF-70]

-2 peptide matches (2 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
6722  744.3549 1486.6953 1486.6576 25.40170.034+1Score > 33 indicates identity
Score > 15 indicates homology		UK.NFGYIDDSISNNK.L + Deamidated (NQ)
16239  945.4849 2833.4328 2833.3494 29.4220.93+1Score > 35 indicates identity
Score > 14 indicates homology		UR.GGHSDWLTQFTKMPWSRSKPVPDK.E + Deamidated (NQ); Dioxidation (W); Oxidation (M)

-113

AccessionScoreDescription
1gi|154699123|gb|EDN98861.1|16hypothetical protein SS1G_13720 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
113.1gi|154699123|gb|EDN98861.1|16554553 (1)1 (1)0.06
hypothetical protein SS1G_13720 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154699123|gb|EDN98861.1|
gi|156033289|ref|XP_001585481.1|16554553 (1)1 (1)0.06
hypothetical protein SS1G_13720 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095457997|gb|APA14948.1|16599603 (1)1 (1)0.05
hypothetical protein sscle_14g097180 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347840155|emb|CCD54727.1|16596993 (1)1 (1)0.06
similar to QUTD_EMENI Quinate permease (Quinate transporter) [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
113.1gi|154699123|gb|EDN98861.1|16554553 (1)1 (1)0.06hypothetical protein SS1G_13720 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154699123|gb|EDN98861.1|
gi|156033289|ref|XP_001585481.1|16554553 (1)1 (1)0.06hypothetical protein SS1G_13720 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095457997|gb|APA14948.1|16599603 (1)1 (1)0.05hypothetical protein sscle_14g097180 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347840155|emb|CCD54727.1|16596993 (1)1 (1)0.06similar to QUTD_EMENI Quinate permease (Quinate transporter) [Botrytis cinerea T4]

-3 peptide matches (2 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
13358+1 1177.0895 2352.1644 2352.1763 -5.060160.046+1Score > 35 indicates identity
Score > 16 indicates homology		UR.TLAQAHAAAHNWLWNFLISR.F + Deamidated (NQ); Dioxidation (W)
13385  1177.5867 2353.1588 2353.1603 -0.65070.62+1Score > 35 indicates identity
Score > 17 indicates homology		UR.TLAQAHAAAHNWLWNFLISR.F + 2 Deamidated (NQ); Dioxidation (W)

-114

AccessionScoreDescription
1gi|347836371|emb|CCD50943.1|16hypothetical protein BofuT4_P022110.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
114.1gi|347836371|emb|CCD50943.1|167850826 (1)3 (1)0.04
hypothetical protein BofuT4_P022110.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
114.1gi|347836371|emb|CCD50943.1|167850826 (1)3 (1)0.04hypothetical protein BofuT4_P022110.1 [Botrytis cinerea T4]

-26 peptide matches (5 non-duplicate, 21 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
3137+1 570.7986 1139.5827 1139.5935 -9.43060.6+1Score > 32 indicates identity
Score > 17 indicates homology		UR.SDTGGLGAPIPR.S
5108  655.8202 1309.6259 1309.6150 8.391160.17+1Score > 33 indicates identity
Score > 21 indicates homology		 K.SGWASANKLNTK.Y + 2 Deamidated (NQ); Dioxidation (W)
12833  1136.0399 2270.0653 2270.1138 -21.4171+1Score > 35 indicates identity
Score > 20 indicates homology		UR.TASPQIPSRSSSPQVNELQSR.F + 2 Deamidated (NQ)
12834+17 1136.0399 2270.0653 2270.1138 -21.41160.046+1Score > 35 indicates identity
Score > 15 indicates homology		UR.TASPQIPSRSSSPQVNELQSR.F + 2 Deamidated (NQ)
12836+3 1136.0403 2270.0660 2270.1138 -21.11100.14+1Score > 35 indicates identity
Score > 14 indicates homology		UR.TASPQIPSRSSSPQVNELQSR.F + 2 Deamidated (NQ)

-115

AccessionScoreDescription
1gi|154697025|gb|EDN96763.1|16hypothetical protein SS1G_01689 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
115.1gi|154697025|gb|EDN96763.1|16334144 (1)4 (1)0.10
hypothetical protein SS1G_01689 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154697025|gb|EDN96763.1|
gi|156063146|ref|XP_001597495.1|16334144 (1)4 (1)0.10
hypothetical protein SS1G_01689 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095448951|gb|APA05915.1|16474014 (1)4 (1)0.07
hypothetical protein sscle_01g006850 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347838575|emb|CCD53147.1|16481695 (1)4 (1)0.07
hypothetical protein BofuT4_P121660.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
115.1gi|154697025|gb|EDN96763.1|16334144 (1)4 (1)0.10hypothetical protein SS1G_01689 [Sclerotinia sclerotiorum 1980 UF-70]
+3 samesets of gi|154697025|gb|EDN96763.1|
gi|156063146|ref|XP_001597495.1|16334144 (1)4 (1)0.10hypothetical protein SS1G_01689 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095448951|gb|APA05915.1|16474014 (1)4 (1)0.07hypothetical protein sscle_01g006850 [Sclerotinia sclerotiorum 1980 UF-70]
gi|347838575|emb|CCD53147.1|16481695 (1)4 (1)0.07hypothetical protein BofuT4_P121660.1 [Botrytis cinerea T4]

-4 peptide matches (4 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
985  451.7382 901.4618 901.4869 -27.8161.1+2Score > 34 indicates identity
Score > 19 indicates homology		UR.QLADAKEK.I
3171  572.3160 1142.6174 1142.5931 21.30141.3+2Score > 33 indicates identity
Score > 28 indicates homology		UR.LAEQQADQLK.A
5212  440.5629 1318.6670 1318.6915 -18.6211.3+2Score > 34 indicates identity
Score > 15 indicates homology		UR.ADDEKITMLKR.L
8217  830.3915 1658.7685 1658.7471 12.91160.043+1Score > 33 indicates identity
Score > 15 indicates homology		UR.NNVMTNHWKDQEK.Q + Oxidation (M)

-116

AccessionScoreDescription
1gi|347842220|emb|CCD56792.1|16similar to carboxy-cis,cis-muconate cyclase [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
116.1gi|347842220|emb|CCD56792.1|16428642 (1)2 (1)0.08
similar to carboxy-cis,cis-muconate cyclase [Botrytis cinerea T4]
+3 samesets of gi|347842220|emb|CCD56792.1|
gi|154700181|gb|EDN99919.1|16406091 (1)1 (1)0.08
hypothetical protein SS1G_02777 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156061269|ref|XP_001596557.1|16406091 (1)1 (1)0.08
hypothetical protein SS1G_02777 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095451980|gb|APA08941.1|16406091 (1)1 (1)0.08
hypothetical protein sscle_04g037110 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
116.1gi|347842220|emb|CCD56792.1|16428642 (1)2 (1)0.08similar to carboxy-cis,cis-muconate cyclase [Botrytis cinerea T4]
+3 samesets of gi|347842220|emb|CCD56792.1|
gi|154700181|gb|EDN99919.1|16406091 (1)1 (1)0.08hypothetical protein SS1G_02777 [Sclerotinia sclerotiorum 1980 UF-70]
gi|156061269|ref|XP_001596557.1|16406091 (1)1 (1)0.08hypothetical protein SS1G_02777 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095451980|gb|APA08941.1|16406091 (1)1 (1)0.08hypothetical protein sscle_04g037110 [Sclerotinia sclerotiorum 1980 UF-70]

-2 peptide matches (2 non-duplicate, 0 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
2811  556.2967 1110.5789 1110.5458 29.90160.054+1Score > 31 indicates identity
Score > 16 indicates homology		UR.WVEIHPNGK.Y + Dioxidation (W)
22803  808.5872 4037.8994 4037.8636 8.87211.1+8Score > 35 indicates identity
Score > 14 indicates homology		UK.NIYGASMKKWSSHSVTSPAEIQHTTSHPMSHDPSASK.S + Deamidated (NQ); Oxidation (M)

-117

AccessionScoreDescription
1gi|154693945|gb|EDN93683.1|16hypothetical protein SS1G_09550 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
117.1gi|154693945|gb|EDN93683.1|1617110210 (1)4 (1)0.02
hypothetical protein SS1G_09550 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154693945|gb|EDN93683.1|
gi|156047721|ref|XP_001589828.1|1617110210 (1)4 (1)0.02
hypothetical protein SS1G_09550 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095458688|gb|APA15638.1|1617110210 (1)4 (1)0.02
hypothetical protein sscle_15g104080 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
117.1gi|154693945|gb|EDN93683.1|1617110210 (1)4 (1)0.02hypothetical protein SS1G_09550 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154693945|gb|EDN93683.1|
gi|156047721|ref|XP_001589828.1|1617110210 (1)4 (1)0.02hypothetical protein SS1G_09550 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095458688|gb|APA15638.1|1617110210 (1)4 (1)0.02hypothetical protein sscle_15g104080 [Sclerotinia sclerotiorum 1980 UF-70]

-10 peptide matches (6 non-duplicate, 4 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
795  440.2377 878.4608 878.4359 28.4082.1+5Score > 32 indicates identity
Score > 24 indicates homology		UR.GEQGVPHR.S
805  440.7300 879.4455 879.4199 29.1012.6+7Score > 33 indicates identity
Score > 17 indicates homology		UR.GEQGVPHR.S + Deamidated (NQ)
2754  554.2767 1106.5388 1106.5204 16.7210.82+1Score > 34 indicates identity
Score > 13 indicates homology		UR.GKSQEKSTGAN.- + Deamidated (NQ)
4326+4 621.3320 1240.6495 1240.6160 27.01160.036+1Score > 32 indicates identity
Score > 14 indicates homology		UR.KTPGPAGNSNGNK.G
5016  651.8534 1301.6922 1301.6762 12.3017.9+6Score > 35 indicates identity
Score > 22 indicates homology		UR.LSQICQQVLGR.F + Deamidated (NQ)
5036  652.8330 1303.6515 1303.6442 5.590160.25+1Score > 34 indicates identity
Score > 22 indicates homology		UR.LSQICQQVLGR.F + 3 Deamidated (NQ)

-118

AccessionScoreDescription
1gi|347827291|emb|CCD42988.1|15hypothetical protein BofuT4_P070640.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
118.1gi|347827291|emb|CCD42988.1|15363553 (1)1 (1)0.09
hypothetical protein BofuT4_P070640.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
118.1gi|347827291|emb|CCD42988.1|15363553 (1)1 (1)0.09hypothetical protein BofuT4_P070640.1 [Botrytis cinerea T4]

-3 peptide matches (2 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
9586  911.9427 1821.8708 1821.8355 19.40150.054+1Score > 35 indicates identity
Score > 15 indicates homology		UK.FANWVNNILNAQMQR.T + 4 Deamidated (NQ)
9691+1 919.4128 1836.8111 1836.8464 -19.20110.53+1Score > 32 indicates identity
Score > 20 indicates homology		UK.FANWVNNILNAQMQR.T + 3 Deamidated (NQ); Oxidation (M)

-119

AccessionScoreDescription
1gi|347836979|emb|CCD51551.1|15hypothetical protein BofuT4_P018570.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
119.1gi|347836979|emb|CCD51551.1|15430578 (1)3 (1)0.08
hypothetical protein BofuT4_P018570.1 [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
119.1gi|347836979|emb|CCD51551.1|15430578 (1)3 (1)0.08hypothetical protein BofuT4_P018570.1 [Botrytis cinerea T4]

-8 peptide matches (3 non-duplicate, 5 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
821+4 441.2639 880.5132 880.5242 -12.5171.1+2Score > 27 indicates identity
Score > 20 indicates homology		UR.RNKPPLR.L + Deamidated (NQ)
1966+1 514.2468 1026.4790 1026.4923 -13.0041.1+2Score > 30 indicates identity
Score > 16 indicates homology		UK.NTFWNFAK.V
4473  627.8068 1253.5991 1253.6186 -15.61150.037+1Score > 33 indicates identity
Score > 14 indicates homology		UK.DMHLVKNPQR.T + Deamidated (NQ); Oxidation (M)

-120

AccessionScoreDescription
1gi|347839918|emb|CCD54490.1|15similar to fatty acid desaturase [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
120.1gi|347839918|emb|CCD54490.1|15633946 (1)1 (1)0.05
similar to fatty acid desaturase [Botrytis cinerea T4]
ScoreMassMatchesSequencesemPAI
120.1gi|347839918|emb|CCD54490.1|15633946 (1)1 (1)0.05similar to fatty acid desaturase [Botrytis cinerea T4]

-6 peptide matches (2 non-duplicate, 4 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
3559+2 589.8283 1177.6419 1177.6706 -24.40121.3+3Score > 32 indicates identity
Score > 26 indicates homology		UK.LSAYITEILR.C
3565+2 393.5558 1177.6455 1177.6706 -21.30150.057+1Score > 32 indicates identity
Score > 15 indicates homology		UK.LSAYITEILR.C

-121

AccessionScoreDescription
1gi|154702172|gb|EDO01911.1|15predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
121.1gi|154702172|gb|EDO01911.1|1544982 (1)1 (1)0.81
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154702172|gb|EDO01911.1|
gi|156057311|ref|XP_001594579.1|1544982 (1)1 (1)0.81
predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
121.1gi|154702172|gb|EDO01911.1|1544982 (1)1 (1)0.81predicted protein [Sclerotinia sclerotiorum 1980 UF-70]
+1 sameset of gi|154702172|gb|EDO01911.1|
gi|156057311|ref|XP_001594579.1|1544982 (1)1 (1)0.81predicted protein [Sclerotinia sclerotiorum 1980 UF-70]

-2 peptide matches (1 non-duplicate, 1 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
3963+1 606.3124 1210.6103 1210.6016 7.241150.039+1Score > 33 indicates identity
Score > 14 indicates homology		U-.MKNNYATALK.E + Acetyl (Protein N-term); Oxidation (M)

-122

AccessionScoreDescription
1gi|154703482|gb|EDO03221.1|15hypothetical protein SS1G_05701 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
122.1gi|154703482|gb|EDO03221.1|15866296 (1)3 (1)0.04
hypothetical protein SS1G_05701 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154703482|gb|EDO03221.1|
gi|156053708|ref|XP_001592780.1|15866296 (1)3 (1)0.04
hypothetical protein SS1G_05701 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095453054|gb|APA10014.1|15924536 (1)3 (1)0.04
hypothetical protein sscle_05g047840 [Sclerotinia sclerotiorum 1980 UF-70]
ScoreMassMatchesSequencesemPAI
122.1gi|154703482|gb|EDO03221.1|15866296 (1)3 (1)0.04hypothetical protein SS1G_05701 [Sclerotinia sclerotiorum 1980 UF-70]
+2 samesets of gi|154703482|gb|EDO03221.1|
gi|156053708|ref|XP_001592780.1|15866296 (1)3 (1)0.04hypothetical protein SS1G_05701 [Sclerotinia sclerotiorum 1980 UF-70]
gi|1095453054|gb|APA10014.1|15924536 (1)3 (1)0.04hypothetical protein sscle_05g047840 [Sclerotinia sclerotiorum 1980 UF-70]

-6 peptide matches (4 non-duplicate, 2 duplicate)

QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
QueryDupesObservedMr(expt)Mr(calc)ppm MScoreExpectRankUPeptide
2908  560.3125 1118.6104 1118.6308 -18.2281.2+2Score > 32 indicates identity
Score > 21 indicates homology		UR.FGSLRNIRR.K + Deamidated (NQ)
6291  718.3497 1434.6848 1434.6811 2.58214.4+5Score > 34 indicates identity
Score > 20 indicates homology		UK.RSQGDNASIRSSR.S + 2 Deamidated (NQ)
9816  617.9505 1850.8297 1850.8718 -22.82110.27+1Score > 33 indicates identity
Score > 18 indicates homology		UR.SQGDNASIRSSRSSQLR.Q + 3 Deamidated (NQ)
9817+2 926.4226 1850.8305 1850.8718 -22.32150.047+1Score > 33 indicates identity
Score > 14 indicates homology		UR.SQGDNASIRSSRSSQLR.Q + 3 Deamidated (NQ)
Page: 1 

Not what you expected? Try the select summary.

Mascot: http://www.matrixscience.com/