Seq-submit ::= { sub { contact { contact { name name { last "zhang" , first "jiayong" , initials "j" } , affil std { affil "College of Chemistry and Life Science, Zhejiang Normal University" , city "Jinhua" , sub "Zhejiang Province" , country "China" , email "zhang3599533@163.com" , fax "086-0579-82281314" , phone "086-0579-82281314" , postal-code "321004" } } } , cit { authors { names std { { name name { last "Zhang" , first "Jiayong" , initials "J." } } , { name name { last "Zhang" , first "Leping" , initials "L." } } } , affil std { affil "College of Chemistry and Life Science, Zhejiang Normal University" , city "Jinhua" , sub "Zhejiang Province" , country "China" , postal-code "321004" } } , date std { year 2017 , month 10 , day 2 } } , hup TRUE , reldate std { year 2022 , month 10 , day 31 } , subtype new , tool "Sequin 15.10 - MS WINDOWS VISTA" } , data entrys { set { class nuc-prot , descr { source { genome mitochondrion , org { taxname "Paratoxodera polyacantha" , orgname { lineage "Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota; Neoptera; Polyneoptera; Dictyoptera; Mantodea; Toxoderidae; Toxoderinae;Toxoderini;Paratoxodera" , mgcode 5 } } } , pub { pub { gen { cit "Unpublished" , authors { names std { { name name { last "Zhang" , first "Jiayong" , initials "J." } } , { name name { last "Zhang" , first "Leping" , initials "L." } } } , affil std { affil "College of Chemistry and Life Science, Zhejiang Normal University" , city "Jinhua" , sub "Zhejiang Province" , country "China" , postal-code "321004" } } , title "complete mitochondrial genome of Paratoxodera polyacantha" } } } , user { type str "NcbiCleanup" , data { { label str "method" , data str "SequinCleanup" } , { label str "version" , data int 8 } , { label str "month" , data int 11 } , { label str "day" , data int 15 } , { label str "year" , data int 2017 } } } } , seq-set { seq { id { local str "Paratoxodera_polyacantha" } , descr { molinfo { biomol genomic , tech standard , completeness complete } , user { type str "StructuredComment" , data { { label str "StructuredCommentPrefix" , data str "##Assembly-Data-START##" } , { label str "StructuredCommentSuffix" , data str "##Assembly-Data-END##" } , { label str "Assembly Method" , data str "seqman v. v 5.0" } , { label str "Sequencing Technology" , data str "Sanger dideoxy sequencing" } } } , create-date std { year 2017 , month 10 , day 2 } } , inst { repr raw , mol dna , length 15999 , topology circular , strand ds , seq-data ncbi4na '14811118422841188111444881821841814418111811848118888 188128888128188882188221441188881888281218881121411884112848818222111181821111 188888484212888121221111848128141111481142811188811428128444882181222211881814 141818882828288882811842221181188211221111822828888811811218811881414481288811 888288818224281188218418814414218411814428814111881188812828228881882228818818 281281121111121818128211224114218222881118188888811882114281884211228288211882 828821811882884821141881181812114118818888128881288221181188288411181121881881 882882218888888811111814214884282288822188418418842288214884884114428811218411 481188428181881882828221882111111824222288884841811888218128814818181181188888 881882111811211881818818214288811884444281884414412811122111888288812411111882 814218888218211821182121884418411818841811211814881814414211188818411888818128 824211888121811821184818214884881828811811214481818811181828228881881212111818 881128228881121121111118814881118881218812811288211812818218814484418812212218 888814418888882281118411884211881188821811812111182828821818821418428821888811 881818218222828841212888128128181812488811818184211228811811881211188214111188 818418881218414818182281111811882121122121118811881818821188811214884818818814 421811811211411182882882828811288188114411412888114881111881112811818228821114 881821181114111188828881148888114228811811118181812218814118842188281181821848 118411812114128841811114141118188282288118118888121118818812281122821422188881 821811111218881182811818842112418418818828211211182181444181884411212888128881 828824411218414214411812884441218218811411888811882411214118814482112284418288 811884414184182111888121184881824811284222184218881881811888888881814811842211 881811884424418884411188418811822228811818844414282284181814218822212481811181 121811418888418818812282288211888812818812811881411411214814111414484284481214 488411214888182212288818214211411884212184214412284284844188811281888888218812 182884224441818211481881814444214811128881881211281811881181811112211888181811 122111222111812288818884888418224844411881214288812888812882888288812284882814 214484281881281818818811214182411128811181228228828884182284284414414444182221 822828182112182818888418828884412182214114888181888811882812224418824441811888 282184811828282184111414441111114114228884481188184411811888414211818284281884 418882844418884814818414282182121818881214814411814184884181212414218188881214 414281211811881884284882221214411881111888881488412884281281818124418281111811 888181222214281288818414218814488821888822888821244884414488811284414811888814 281188214211884181821888812184181218188184884884222188882188184888818211814414 284888884211881814214448881882128418182288818881224488811228811182211228418811 111412118888811211818881884414811128811288828822282112188822814418818284481842 212412418188214188122284124218181288428411181884818218281814488281811828288882 884284881881818881888881882818414111411811418284182412214818818828218212111841 181488241884118411212881188812242221284112181248181184118811212881881281118118 281888122218881118111818882811848442141181484211844188811428221811181114818181 888188128888888141122111844221818181818218814488842114181484218212222881814112 118811818188882184122188211818881881881211811884811211814814218181811818818212 811811281182118881284182412124881814184412118188814111822818411281882812224221 884818811888881884212842288222882111882818182811884124111188281182211288811288 811111211884412182118418188411488184118188284188884284181814118884188228121811 882222111184111881181184481882482888814114844181122411211288812211811181228811 222411822811881218284114184811882128218411281882281411884414811114284124281212 214412418811182114221228888418881182482284484818888184412118428224111828484414 211182121418881812281884884824111481818221881184128888811288411888281888818224 148141814811818142118812882841841111411488148811114181121881181848218188111188 188121821418412841111421148118448282881112214814181481181814211881288284184111 141148814881111418112188118184821818811118818811811488118811812182888188221211 181181222884118844881181288888881288882128181288888881884481118181888122818818 188188214188111822421882111144141211111121188888111121881118841111841811211188 848888214818884182248248221181881811188818211811128411211411881411884488818811 811882211818211818411811882288212441128811818818411184811884221181118812184114 118881112882811884411111441881881181114418211288884888881888281812888128881888 818181121188881814488818882218181888881211411211412181814811811222888288814288 812288818418811418881818818884488414881181121281118121818884222182814882282114 411282284418288811812288881814818421884111281881411181811822422214481218818211 882488814214211181841884284442128818811811222888814411181214411188281811882888 222888812218842811888811882111882888818811818814118214214814281811882118218184 888884284818811411288818188281414114811188118482218181211811821822181821288148 812181814122884122118818842142812114118818148142118188144888818811181882881841 188811841811128218188148144118188118188118188112118818821184184124141848248124 141114112888821144184821212818111148118112144188124184144118118888188818848182 141148188888288818882188288284112188881821814214888182122842848441888144882182 184122222821144818818822888811842828821118822128428811812112848828128842882144 118812818812184114121221844188188141111811881811821142114821144888118188812818 818188144118481288212842828821188181841181881841142122288812818812141282118888 844882812188888848142812244188821844828821848118818844882812288828818812184888 112224118118888818121288812182211821221288844188841142142142884181884121888848 841848848884188188888181848182818881284184144144181888188811818188114818188841 888221182111144828182228181411811181184188822288128188181888281181188122821188 822288188188181481881148218888881428111114881188411112244411111141828228888411 842441888418221111821828828244282221888821881241888888881188424188188888881188 888418481411188421881188881228188822188188228881812821118188181121841141188121 141882182882182881188881881122441881818218411841118211448821881118841422111811 111881444884814881118181124888418884218881111148188411188821182812288118881148 114111211188118848118214888241228418148114181818181811818228812882884188411122 111814144818111812242211181111188144488481488111818112488841888421888111114818 841118882118281228811888114811411121118811884811821488824122841814811418181818 118182288128828841884111221118141448181118122422111811111881444884814881118181 124888418884218881111148188411188821182812288118881148114111211188118848118214 888241228418148114181818181181822881288288418841112211181414481818812848811811 818118841188218188221188114114184848141124148411142842811288848188211484488111 182218881218288118881818148881181481111218812188882188481111181118188882118888 818111818888188211141811818818282118112142882118488181282818181141812884118114 211881881881114181181112811811111111881281118114188811118818811228411122188418 881212882881828881811181821148181111888414412211148188212882112281818281818188 811844118811182212288211411184188882881222288884811111811114481811182181814112 214111111811821118818118118811111814811118118112881112818188811181811882812221 182181112281181112881281811884411441188881821181144421112111811148114414881811 111881882118881111182812282211111284211111881881112281881882218111881881882118 828288212821128818181814411881818811118282282121111218118111181112411114118112 141284881112214814181411118121181818121811181818881118882881184111281228221111 881818288884118111182214221141114481882212111484211118884111821811112184184144 881114421811111814181118882281811112411818228411118828821218818411811281822244 212181811181181184228811181114218484881181118411111144281118214118182281114181 111882881881881182281188442881144884181184211811888888881148218188211118884282 281182284181811181884881111214111881281181111882881881122118814411111882882811 122411881181118111222214214811281184884184118411281144284181284414884444284281 884214214481182184214111114411888414282888884881414284211221281281111184111811 812111188211182818211181142118881218111114818118822182822211118841881882184211 814281881181114211218282211822418814181114284821181812214218818184188811218888 418118111881281112118114111881182221112218282112281111141882811881118884482811 811881111181881814181181211181881111281111111411222448881184811818212221181818 118228282818181111811281114114111881181811211112881811181181184181882118211181 181184881811211884114114118881182881811888282128221211118111818818818881811812 118181112881118811182221181184181111881181111411111182841811112181184181118181 821811228114181188281818281841212212111821881888818188111281288114811181112118 821818881118811812118182828228811418211811188811144811821184811818811814811111 882824421128122128818828828181118122141181188118122184884128181841181811181811 148481842142828111411841118818818811811811818112818821818821428112818828188111 811122118882122811814188118841144144442842818488128841241114818111821821811142 218828844818811188811114222888188118811811128824128822211824282181121118188142 811121111811122141441121811122184142418818811148111141818181118822821141188811 148818811122822118812811122818184142812141841181142118811142888818182212284124 811121818811828812811111822222812811828118148118821118812188818148118422118828 212811181822111112824811811822181822822811888211811112122142811118218141122841 112144442282112184142888844811821811184818811181818144818888112211111142218118 818828818181811181812188818121182188181888188111441111118111211888818184188481 811181211814222818811811844811141142411811148181111114811181818222142884811124 882144884181822221122181118811411811148144118811128122882111111118181111141118 818188121128121111148121121114818811811811811811118814111811111211184188181111 288181224118812841181128842218118818811118121118221111128811818148811222181841 811181182188122111818481828811188828821122411111182118888111111111818111141418 111411818811188884812818821821122188888811111121811144448818111112818821111818 481818811218848118111221111411881111811821881221841281241188188418128111181418 111222111421228821211128421111418114111188181481121818112822228822188122118121 811811818111181181118114121141121181112828118288118111488188118111848881248881 411211111128212111221211181118182111841118188188142188448888118148881118111121 884482884811122111111114884812888811112882111441114111112881821281182222111188 118188881188111281222888411188181812288881181141181141181128282141182142888881 888281118218221881821181441881182281888881211421188281181842881188141448841181 821881141888841888822812182288881881188818288441441181881488281888181812481128 142288422821118411181888881818821118181184188181122288888888281222441888881188 881188818818481118888818818221488118288818411148181411118118888181882111121128 218118188882881881111181818118211221181112881188121182181188421828818288888881 121881188444481488111188188818188818111441228881248211181888811841181112288812 441111812122288811881111888221181184218814814182882281222218281181888218228418 411128884448212888814481888428818811822141828881214412818888814211812128188214 212121884182814218881211414814222181888482414124821188824418412822822481282882 184281184414228288818888881888481888122882121884412414482888188181418288181118 888188121218411211884414841881888818822814821814281224228881814488124888812288 414442111818218888414414211214811881221188818818284211882228122814411884118814 882118444888414484488884214814181184281218811122448828821288822188884888812288 881881881214214814811811882182812888888812182111284428211181182218814414811181 411181884181111882288822182218188881218881144181888814488881881881818881841882 888222888818222881114112288121888814414182214121188881822224211182288814811212 284882181882112214118448188822818824228184281882822418211882281181112884414484 811884222814881818281884211888818884888812288881414111121188222414412882118188 182281881122118881818828411841814811811884821828818811288411884414282482214884 114182218181888811284482111888811224811818128888818188181882881182288811811281 111818414188181888818881128118181488148818111288288411811418818422884111821811 811114448881118222881881128818881288188811422881111111118288811222214181111818 811111488811841112144811111828228821142811181218211888182181124181124844811148 122224112821118181811111122118111114112888812181111811111141184811182141122818 111118118421828811818828218111811118828841181882128811111118811842111122822828 822181882112188111222841112811882141882122882142111182111144828124188148882142 114121141112111221118188121811144111811111111811111821118122118884181181411111 182811811141181828128118211111812111141811811118811842811128812282181141118148 884142812242424811122822214811142181188141488841141221122142211818118148181112 122818128148121811811111111111811822211188111188111818122128818181244218811818 821811111811141811111811441111112844121818181181811811181188141112214844188118 184282888121111811288118142182828111144884114118822818111822812288188144122888 824211184118181822811112888124882811811148111411142812122812811812111118118811 118812128112111418811112181111882188128811218181281288184188818181821818181814 188281118281881212881118828422111181481881881181882118888811111188188281118188 844822888248128111181888811888188111418141112211228442881212244888111282141821 848114118881111482411214128811881884118122842122218118821828811822112182414482 121182822888282418814112828211111411881842848818222811448118881182881811821881 888184418228811188188818188188111182111411414888118881828828118212222118811181 112882181881188111118811888811128211881181281841181881112828181444828828248222 881188181888114218888812881111488111882118888821821111181141214888881228248221 122188218822142288211881111412811841881842812288842121482111181284244222888111 888882148444214482111888228181811888188188121141112218488888118111214424142111 118888428811882288188881111812211188188112818882184188888488881281188111821888 881881114888881118822128881218888118111111188111811114888118848121841211411881 148888112122288811881181121118828111882121111882818111821821188188181188181888 811141488888222288111118811481212111181118128882122118111881818118881142128284 118811188218881881111112814181882881111124118112188821881221188141118828811811 888841112188118811218882811881118288881128824141111188118811111188818882118281 282841812121141812118111811118811288281881188181111118188821841888222881214812 811812888181481111181188182821182118828121821121811182818888118214888121188848 818811848118811812118818181118882141881818241182421241811181188821484811184111 18288112888114288112284888188111882888281441121828822418121A281288848812412881 828212288118118414148412444241848481218188181414281811182188881121182811181111 881211881118221228821118118888111481188182248118111812188881184811822188188811 288181818881284212288412884111882888881881421218281411118112281111181818821811 121424481812114181181181811481141882142424412818241881218112141882282811181412 818118122422111882888114888211418218182812811812821148881118488881211811111811 814448182811822814888121828821188824211882188288128828121888118112228111181881 188818882122288111818288118811818811122211118118118812882111128118118188818884 118881884818112242441842844212118888112211882811881121888122111828111121228811 818111811118818281284211112212288814188822888141118111112118121111181812181814 182118488111181118181181142114118111128211111288888128812188284128118441811188 181118814882811828128888818128824211888121811821112141181888884818888112188418 881418211221422111881148111182242111144228822282221114411111818888422211818818 828111211848882811121884411814818281281811281842814188221888888882228888111844 118281421814881814814181281881881881818118121848181848181811188188811811212184 818184818181118818881181181818182812288112841881184141181188441181212282118141 888811818811112228888888828122218181448818811122884111111824884281418218124118 118481118111828822888181141288818181818111144814181188122188184821881881818882 414211214822112881184881222811111811121142188111181111888888148221124488881111 88828881114118184118212111188411440'H } , annot { { data ftable { { data rna { type tRNA , ext tRNA { aa ncbieaa 73 } } , location int { from 0 , to 65 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 81 } } , location int { from 89 , to 158 , strand minus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 77 } } , location int { from 161 , to 228 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 87 } } , location int { from 1263 , to 1331 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 67 } } , location int { from 1331 , to 1393 , strand minus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 89 } } , location int { from 1394 , to 1458 , strand minus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 76 } } , location int { from 3042 , to 3113 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 75 } } , location int { from 3879 , to 3950 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 68 } } , location int { from 3952 , to 4021 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 71 } } , location int { from 5641 , to 5704 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 65 } } , location int { from 6064 , to 6128 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 65 } } , location int { from 6248 , to 6312 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 65 } } , location int { from 6432 , to 6494 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 82 } } , location int { from 6133 , to 6202 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 82 } } , location int { from 6317 , to 6384 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 82 } } , location int { from 6499 , to 6566 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 78 } } , location int { from 6567 , to 6631 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 83 } } , location int { from 6632 , to 6698 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 69 } } , location int { from 6699 , to 6768 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 70 } } , location int { from 6772 , to 6835 , strand minus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 72 } } , location int { from 8568 , to 8630 , strand minus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 84 } } , location int { from 10257 , to 10319 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 80 } } , location int { from 10320 , to 10382 , strand minus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 76 } } , location int { from 13056 , to 13125 , strand minus , id local str "Paratoxodera_polyacantha" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 86 } } , location int { from 14445 , to 14514 , strand minus , id local str "Paratoxodera_polyacantha" } } , { data gene { locus "ND2" } , location int { from 229 , to 1260 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data cdregion { code { id 5 } } , product whole local str "Paratoxodera_polyacantha_1" , location int { from 229 , to 1260 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data gene { locus "ND1" } , location int { from 12110 , to 13045 , strand minus , id local str "Paratoxodera_polyacantha" } } , { data cdregion { code { id 5 } } , product whole local str "Paratoxodera_polyacantha_2" , location int { from 12110 , to 13045 , strand minus , id local str "Paratoxodera_polyacantha" } } , { data gene { locus "ND3" } , location int { from 5705 , to 6058 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data cdregion { code { id 5 } } , product whole local str "Paratoxodera_polyacantha_3" , location int { from 5705 , to 6058 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data gene { locus "ND4" } , location int { from 8639 , to 9970 , strand minus , id local str "Paratoxodera_polyacantha" } } , { data cdregion { code { id 5 } } , product whole local str "Paratoxodera_polyacantha_4" , location int { from 8639 , to 9970 , strand minus , id local str "Paratoxodera_polyacantha" } } , { data gene { locus "ND4L" } , location int { from 9964 , to 10245 , strand minus , id local str "Paratoxodera_polyacantha" } } , { data cdregion { code { id 5 } } , product whole local str "Paratoxodera_polyacantha_5" , location int { from 9964 , to 10245 , strand minus , id local str "Paratoxodera_polyacantha" } } , { data gene { locus "ND5" } , location int { from 6836 , to 8555 , strand minus , id local str "Paratoxodera_polyacantha" } } , { data cdregion { code { id 5 } } , product whole local str "Paratoxodera_polyacantha_6" , location int { from 6836 , to 8555 , strand minus , id local str "Paratoxodera_polyacantha" } } , { data gene { locus "ND6" } , location int { from 10376 , to 10879 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data cdregion { code { id 5 } } , product whole local str "Paratoxodera_polyacantha_7" , location int { from 10376 , to 10879 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data gene { locus "cyt b" } , location int { from 10879 , to 12015 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data cdregion { code { id 5 } } , product whole local str "Paratoxodera_polyacantha_8" , location int { from 10879 , to 12015 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data gene { locus "ATP8" } , location int { from 4022 , to 4180 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data cdregion { code { id 5 } } , product whole local str "Paratoxodera_polyacantha_9" , location int { from 4022 , to 4180 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data gene { locus "ATP6" } , location int { from 4174 , to 4854 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data cdregion { code { id 5 } } , product whole local str "Paratoxodera_polyacantha_10" , location int { from 4174 , to 4854 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data gene { locus "COX1" } , location int { from 1459 , to 3015 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data cdregion { code { id 5 } } , product whole local str "Paratoxodera_polyacantha_11" , location int { from 1459 , to 3015 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data gene { locus "COX2" } , location int { from 3118 , to 3801 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data cdregion { code { id 5 } } , product whole local str "Paratoxodera_polyacantha_12" , location int { from 3118 , to 3801 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data gene { locus "COX3" } , location int { from 4854 , to 5640 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data cdregion { code { id 5 } } , product whole local str "Paratoxodera_polyacantha_13" , location int { from 4854 , to 5640 , strand plus , id local str "Paratoxodera_polyacantha" } } , { data rna { type rRNA , ext name "16S ribosomal RNA" } , location int { from 13126 , to 14513 , strand minus , id local str "Paratoxodera_polyacantha" } } , { data rna { type rRNA , ext name "12S ribosomal RNA" } , location int { from 14446 , to 15288 , strand minus , id local str "Paratoxodera_polyacantha" } } , { data imp { key "D-loop" } , location int { from 15289 , to 15998 , strand plus , id local str "Paratoxodera_polyacantha" } , qual { { qual "allele" , val "control region" } } } } } } } , seq { id { local str "Paratoxodera_polyacantha_1" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 343 , seq-data ncbieaa "MPNNSTKILFLMTLISGTLISLSANSWLGAWMGLEINLLSFIPLLSTNKNMYS TEASLKYFLIQAIATSSILFMILVKINMQELFYFTSNNSWNNIIILPFFLKMAVAPFHWWLPSVVEGLTWSNCYIILS IQKIAPFVMISYLVYNNFFIQMTIMLSALIGAIGGLNQISLRKILAFSSINHIGWMLMTMVMGANLWILYFAIYMINV SVVILMTGMLNISFITQMFNSFNNKKLVKFTLLTSMLSLGGLPPFLGFFPKWIAINFMMQNLFMFSCFILIMSSLLTL YYYMRLMYATLMITNSENLWFTWVYPKMIHNHKLIMFNLTVVLLGMMTSNLLLLTY" } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 2" } , desc "ND2" } , location int { from 0 , to 342 , id local str "Paratoxodera_polyacantha_1" } } } } } } , seq { id { local str "Paratoxodera_polyacantha_2" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 311 , seq-data ncbieaa "MLSNEFYVLIFVSVILIIFVLVGVAFFTLLERKVLGYIHLRKGPNKVGFMGIL QPFSDAIKLFCKEHINPLVSNYLLYYMCPVFSLFLSLFLWMLMPYMSGMFNFNLGLFFFLLCTSMGVYTIMLAGWSSN SNYALLGGLRAVAQTISYEVSLALILLSFVFLISSYSLLDFFYYQIGIWFLFFLFPLCNIWFVSCLAETNRSPFDFAE GESELVSGFNVEYGSGGFALIFLSEYSSILFMSMLSCIIFMGSDLHSFLFYVKVLFIGFLYIWVRGTLPRYRYDKLMY LAWSSFLPVSLNFLMFYLGLKIFF" } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 1" } , desc "ND1" } , location int { from 0 , to 310 , id local str "Paratoxodera_polyacantha_2" } } } } } } , seq { id { local str "Paratoxodera_polyacantha_3" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 117 , seq-data ncbieaa "MISLTIMFLMITSISLIIMVLSHFLAKKLIENREKSSPFECGFDPKSSSRLPF SLRFFLIAIIFLIFDVEIALILPISIIPLYSNIMTWSITSFIFILILLTGLYHEWNQGSLNWAK" } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 3" } , desc "ND3" } , location int { from 0 , to 116 , id local str "Paratoxodera_polyacantha_3" } } } } } } , seq { id { local str "Paratoxodera_polyacantha_4" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 443 , seq-data ncbieaa "MLMYMFWMVFMTPLCFLKNGWWMVQNLMFFISFMFFFKIDFFGWSNLSYMFGN DYLSYGLTMLSFWICILMIMASYSVIRYKFYNHLFLFLILLLLLMLCCTFCSCNMISFYIFFEGSLIPTLFLIYGWGY QPERLQAGMYLLFYTLFASLPLLMGLLYLYNHMKLFIFSFNKYNDCMNVYLYMSMIMAFLVKMPMYLMHLWLPKAHVE APVSGSMILAGVLLKLGGYGLLRVFGYLVSIGITMNVIWITISLVGGFLVSLMCLRQVDMKALIAYSSVAHMGLVIGG LMTLNSWGIYMSFTLMIAHGLCSSGLFCLANICYERLGSRSLLINKGLLNLMPSMALWWFMLSSSNMAAPPSINLLGE IGLFNSMVSWMWMVMLLLMMISFFSAAYTLYLYSYSQHGINYSGIYSSMSGSCREFLLLMLHWLPLNLLILSSDIVLI " } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 4" } , desc "ND4" } , location int { from 0 , to 442 , id local str "Paratoxodera_polyacantha_4" } } } } } } , seq { id { local str "Paratoxodera_polyacantha_5" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 93 , seq-data ncbieaa "MLMMFHLMFICGLWVFCSKRKHLLMTLLSLEFIVLVLFIILYYYVLVMEGELY VTMIFLSFAVCEGALGLSILVSMIRSHGNDYFNSFGLLQC" } } , seq { id { local str "Paratoxodera_polyacantha_6" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 573 , seq-data ncbieaa "MYLSLCFISFFLLLILSLLGFNLSLYCIMNNNIYFVEWEIMSLNSSSIVMTLL FDWMSLLFMSFVMLISSLVILYSEDYMLGDITLNRVLFLVLMFVLSMMFLIISPNLISIFLGWDGLGLISYCLVIYYQ NVKSYNAGMLTALSNRIGDVALLMAIAWMINFGSWNYTFYVNCLFDSFEFCIISFLVVVAALTKSAQIPFSAWLPAAM AAPTPVSALVHSSTLVTAGVYLLIRFSSIFPNWLMSILLVISVLTMFMSGLGANFEYDLKKIIALSTLSQLGLMMSIL SLGYSDLAFFHLLTHALFKALLFMCAGMVIHNVKNFQDIRFMGNLSIFMPLTSSCFMISNFALCGMPFLAGFYSKDMI LEVVSLSNLNMFMYMLYFLSTGLTVCYSFRLFYYVLWGDFNMIPMYKLSEENWMMIYGMMGLMIFAVFGGSFLNWMIF MTPYFICLPLLMKFLPIMVSLLGLWLGSIMFKYSLSYYFTIFNYYNLIIFSGSMWFMPFIFTKGVSKSFLEGGFNSIK YMDMGWSEYFGPQILYLMFMKMSSVNQWFQVNNFKSYLVIFFISLLSLMMIA" } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 5" } , desc "ND5" } , location int { from 0 , to 572 , id local str "Paratoxodera_polyacantha_6" } } } } } } , seq { id { local str "Paratoxodera_polyacantha_7" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 167 , seq-data ncbieaa "MMYLLMSMSMTLSISFLFLNHPLSMGLILFLQAILMCLISGWMSLSFWFSYIL LLIYLGGMLVLFMYVTSLASNEMFLYSNMMIMTLFFLPGFLILIYYVNFYYPVNLYESMENNFMFKTTHNIFLLKMYN QPMNLITIMIASYLFLTLIGVVKIIYIYKGPLRQMF" } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 6" } , desc "ND6" } , location int { from 0 , to 166 , id local str "Paratoxodera_polyacantha_7" } } } } } } , seq { id { local str "Paratoxodera_polyacantha_8" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 378 , seq-data ncbieaa "MNKPLRKMHPLIKISNNALVDLPTPSNISSWWNFGSLLGICLLIQIFTGLFLA MHYSAHIDLAFTSVAHICRDVNFGWLLRTLHANGASLFFICIYLHIGRGLYYSSYKFYYTWTIGVIILFLVMATAFMG YVLPWGQMSFWGATVITNLLSAIPYLGIELVQWVWGGFAVDNATLNRFFTFHFVLPFIITAVVMIHLLFLHQTGSNNP LGVNSNIDKIPFHPYFTFKDILGFIIMFMILSLLSLKEPYILGDPDNFIPANPLVTPVHIQPEWYFLFAYAILRSIPN KLGGVIALVMSIAILFVLPFSENNSRGLQYYPINQFMFWMMVMIVILLTWIGARPVEDPYILTGQILTVMYFLYYILN PLMTKMWDYILFN" } , annot { { data ftable { { data prot { name { "cytochrome b" } , desc "cyt b" } , location int { from 0 , to 377 , id local str "Paratoxodera_polyacantha_8" } } } } } } , seq { id { local str "Paratoxodera_polyacantha_9" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 52 , seq-data ncbieaa "MPQMMPLNWLMLFLLFTMLFLLVNMFTYYIIQIKSAFKSSQKTIFKTLNWKW" } , annot { { data ftable { { data prot { name { "ATP synthase F0 subunit 8" } , desc "ATP8" } , location int { from 0 , to 51 , id local str "Paratoxodera_polyacantha_9" } } } } } } , seq { id { local str "Paratoxodera_polyacantha_10" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 226 , seq-data ncbieaa "MMTNLFSVFDPSSNIMNLSMNWTSISIGLLMIPMSMWMIPSRNLMLWNVIANK LHEEFKLLIGKSIINKGSTFVFISMLYFILYNNFMGLFPYIFTSTSHMVMTLSLALPLWLSFMLFGWVNNTKYMFAHL VPQGTPGSLMPFMVCIETISNMIRPGTLSIRLAANMIAGHLLMTLLGNTGNSMILSLLPLLILIQILLLMLESAVAMI QSYVFAVLSTLYSSEVN" } , annot { { data ftable { { data prot { name { "ATP synthase F0 subunit 6" } , desc "ATP6" } , location int { from 0 , to 225 , id local str "Paratoxodera_polyacantha_10" } } } } } } , seq { id { local str "Paratoxodera_polyacantha_11" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 518 , seq-data ncbieaa "MKTFNLMLQRWLFSTNHSDIGTLYFIFGTWAGMLGTSLSILIRTELGQPGSLI GDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLIPLMLGAPDMAFPRMNNMSFWLLPPSILLLLISSTVESGAGTGW TVYPPLSASIAHAGPAVDLTIFSLHLAGMSSIMGAVNFITTMINMKPIYMNQTQMPLFVWSVGITALLLLLSLPVLAG AITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHVISHESGKKEAFGNYGMIWAMSAIGF LGFVVWAHHMFTVGMDVDTRAYFTGATMIIAVPTGIKIFSWLATMYGSKMIYTPATLWALGFIFLFTVGGLTGVILAN SAIDIILHDTYYVVAHFHYVLSMGAVFAIMAGFIHWYPLFTGLTLNPTWLKSQFLTMFIGVNLTFFPQHFLGLSGMPR RYSDYPDAYTCWNIVSSMGSMISFLAVIMFIFILWESMSSDRPVLFSSQMNSSIEWTLNLPPTEHTYNELTLITK" } , annot { { data ftable { { data prot { name { "cytochrome c oxidase subunit I" } , desc "COX1" } , location int { from 0 , to 517 , id local str "Paratoxodera_polyacantha_11" } } } } } } , seq { id { local str "Paratoxodera_polyacantha_12" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 227 , seq-data ncbieaa "MAMYMSLGLQDSASPLMEQLMYFHDHSMFIITMIVTMVAYMMLSLMTNQFTDR HVMDGQYLEILWTILPAIVLIFIALPSLQILYLIDENSNPTLTLKTIGHQWYWSYEYSDFADMEFDSYMIPQNEINNG IRLLEVDNRTTLPMNTLTRILITSEDVIHSWTIPSIGVKADATPGRLNQATFWFNRPGVFYGQCSEICGANHSFMPIV VESMSINDFLTWISILSE" } , annot { { data ftable { { data prot { name { "cytochrome c oxidase subunit II" } , desc "COX2" } , location int { from 0 , to 226 , id local str "Paratoxodera_polyacantha_12" } } } } } } , seq { id { local str "Paratoxodera_polyacantha_13" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 262 , seq-data ncbieaa "MSMYNNHPYHLVTYSPWPIIAATSIMVAMLGFIKYSYEFNDKLMLVGMLMLML TIIQWWRDVVRESTFQGCHTMKVMTGLRWGMILFIVSEVFFFISFFWTFYHSSLSPAVDLGSSWPPQGIIPFNALQIP LLNTTVLLASGITITWSHHGLLENNYNQASQGLMFTIMLGMYFTALQLYEYYEAPFTITDSIFGSTFFVATGFHGLHV IIGSTFLITCLTRMIFMHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGG" } , annot { { data ftable { { data prot { name { "cytochrome c oxidase subunit III" } , desc "COX3" } , location int { from 0 , to 261 , id local str "Paratoxodera_polyacantha_13" } } } } } } } } } }