Seq-submit ::= { sub { contact { contact { name name { last "Zhang" , first "Jiayong" , initials "J." } , affil std { affil "College of Chemistry and Life Science, Zhejiang Normal University" , city "Jinhua" , sub "Zhejiang Province" , country "China" , email "zhang3599533@163.com" , fax "086-0579-82281314" , phone "086-0579-82281314" , postal-code "321004" } } } , cit { authors { names std { { name name { last "Zhang" , first "Jiayong" , initials "J." } } , { name name { last "Ma" , first "Yue" , initials "Y." } } , { name name { last "Zhang" , first "Leping" , initials "L." } } } , affil std { affil "College of Chemistry and Life Science, Zhejiang Normal University" , city "Jinhua" , sub "Zhejiang Province" , country "China" , postal-code "321004" } } , date std { year 2016 , month 5 , day 29 } } , hup TRUE , reldate std { year 2021 , month 5 , day 31 } , subtype new , tool "Sequin 15.10 - MS WINDOWS VISTA" } , data entrys { set { class nuc-prot , descr { source { genome mitochondrion , org { taxname "Toxodera hauseri" , orgname { lineage "Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota; Neoptera; Orthopteroidea; Dictyoptera; Mantodea; Toxodera" , mgcode 5 } } } , pub { pub { gen { cit "Unpublished" , authors { names std { { name name { last "Zhang" , first "Jiayong" , initials "J." } } , { name name { last "Ma" , first "Yue" , initials "Y." } } , { name name { last "Zhang" , first "Leping" , initials "L." } } } , affil std { affil "College of Chemistry and Life Science, Zhejiang Normal University" , city "Jinhua" , sub "Zhejiang Province" , country "China" , postal-code "321004" } } , title "complete mitochondrial genome of Toxodera hauseri" } } } , user { type str "NcbiCleanup" , data { { label str "method" , data str "SequinCleanup" } , { label str "version" , data int 8 } , { label str "month" , data int 12 } , { label str "day" , data int 14 } , { label str "year" , data int 2017 } } } } , seq-set { seq { id { local str "66-HSJT" } , descr { molinfo { biomol genomic , completeness complete } , user { type str "StructuredComment" , data { { label str "StructuredCommentPrefix" , data str "##Assembly-Data-START##" } , { label str "StructuredCommentSuffix" , data str "##Assembly-Data-END##" } , { label str "Assembly Method" , data str "seqMan v. v.5.0" } , { label str "Sequencing Technology" , data str "Sanger dideoxy sequencing; IonTorrent" } } } , create-date std { year 2016 , month 5 , day 29 } } , inst { repr raw , mol dna , length 15616 , topology circular , strand ds , seq-data ncbi4na '44811118422841181114448818248418144181118118481188881 881288881281188822488221141188881888281219881121411884112842118222111181821111 188888484282288121221111848128141111481142811811818811428188444882181222211881 814141811182828288882811842221181188211211111822828888811841218811881414481288 811888288818224281128218411814414218411814428814111881188812828228821882288848 818218221121141181818828211224118248222881118188888811882114284884218288211211 822818881811882881811111881181812114118818822128821288211181188888411181181881 881812822212888811811111844244844282228822128418418812212214884884114418288218 411211128428881821882888221882111111884282228821222811888288188812818211181182 881881882111811811881822888214228811884414281884414418811122111828288812411111 882814228888218211881182121884488411811811881811841881844448211181818411888848 188821221888181211821184818211881881822881814211411882811181828228881881212111 288881122228811121121111118814811118881248818841228211818818218814484488842212 218882884418828882211118411884211882188821811812111122828814818811418488821828 814882818228228812811282888128188182812428881818188211248811811881211188214111 188818418881212811888122211111111821888188211181881821818881128818211821828818 814481811814211411282822822818811218188114428881148811122111281181822882111488 181118111411418882888114828814222881114228814811288881812122188141188421882811 818218811184118121141222841811114141188188822228811814288812111281881228118128 214221888818228888148211818118882488288421124184188188282112111821811441818844 112128281888848288244842284182144218128244112282888114118228118824112141128144 821122444182288118844141841821118881811848818848812142221842288818818418888888 818148118122118818118844844888844111884188148822228118188144842822841818142888 822124118111811218114188884188188122122882118828188188188118814114218448141114 144142144112144184112148881822222888182242114118842821842144822842448441888142 118888882188121828842244818182114818818144842148111288818812112818118211218111 122118881818111221112121118122888188818884182148244118812142188188428828128882 188122848888142144842818812118128188112141824111888111212182888888241222842844 144144141822818888181821121288188884188288844121822841148881818828118228122844 288844118118882821848118882221841114144111111141142888844811881844118118884142 118182842818844188888144888848448184442221221818488812148144118141848841812124 142881888812144142412118418818842848822112144118811118888814284428842212118181 844112811148118881812122142182888184142188144888818288228888812148844144188112 144148818288142211882142218841818218888121241212181281848848842221888221881848 888182118144142848188842118818142144188218821284181222128188812844828812288111 222111884188111114221188888112118188818244148111888112888288222121121888288144 188142844118122124124181882141881822841842181212284284111818848182182118144482 118118882188218242248818818188218888218888184141114118114142111224122148118188 882182121118111814282118841184142128811288122822242841121812881811841188412188 118812811181121228281181844214188148424484418881142822121818111411221188128888 888141111118442812188218182888844888121141814842282122128818141121188118181888 821841821282818188218818812118118848812112148182281818118188182188118112211811 188212841824121848818141844121181828141118288184112818828122242218848188118888 818242188122882228821118888181228118841841111882111822412188112288111112118844 121821184181284114881841181882441288812841218841188841882881818112122821111841 118111811844418824828188141148841211224112112828122218111812288412224118828218 812182841141848118821882184112118822814818844148111142841242812122144124188111 821142212888884188811824822844848188881844421184882841118884844142111821814188 818122118848818841114848181812211841888888111284418888114288182821181111814211 881288284184411141448814881118218112188118184821818811148112182141841284111142 114811844828288111221481118148111181421188128828418441114144881488111821811218 811818482181881111811881881821181181218288818222121118118122288111884188118128 288242888888848818188888188828228111818228811281881212148888211811182112282111 418214221111122144881811112888111884411184181121118881888821488888418222824822 118188181118281821181112841488141188821188441881881881182221181821181841881188 228821244118881128881841118881188188118111281218411411888111288282182441114111 111188118111441821128888181888188828481282818818182881218118118888181442281888 221818188882121141121148218181122181128282821881428881222881841881141888181188 888448841182118118128111218184888422218288488224211441121228448228881181228888 181481848188411128188141118181182248221441128288421182248881421421118181188424 441212281881181122288281441118121444118828181428288181188481228888881182882128 211188281288881121881411824421481428181182211821812481888428481881141121881818 828141414481112811841211811181281182182288182182814888218121412288412241884814 224281811411881811811281812814418181821118188288184118181184111142881818821814 411818811848811888811211211882118418412414184884882414111411288882114418182181 281114144881811214412812418414411811828848881884818284114818828828881888218888 888411218828182181411428814282284244844188814418248218412222288814441881822288 881184212882111882282882881181211284828812824228214481881211821288411482182121 412841814111121188121182114211112114418811848811281882818814481888188881288282 882118818184118188184114212288821281881214128211888824488281218828884814281284 418882184422882184881881884488281228822888881218488811282411811818281812128881 218281182122128884418884114214214288418188412128884884184814828418818888818184 818221828128418414414488188818881181818811481818884188822118211111482811418881 814118111811841888222821281811214222881881821282811888228881824881811818811422 188828841481111142811884111482444111111418222288884148484488884122281818288228 282422882218888212812418888888811824211881828888811888884184814111884218848848 842221888221881882228411188211181881814218411411881211481881228821888811882818 811884418818182184118411122114488218811188414221148118111114448848148811181811 218884188842188211111481884111882211828122881188811481141112111821188484182148 882412284181184141818188181822881888418884488848888888882814884111221118814144 818188128488118118181188411488111882211881141141848481411241181411428428112881 181882114844881111822188812182881188818181488811814211112188121888821884811111 811181418188881888818111818882818221114181181881828211811214288211848818128281 818114181888411811121181118111111188111418111281181111111188128111811418881111 821881188841112212841888121284282118888181888118141818111888848444221111818828 288211228114828181818881188411881118228118111141114418888282128228881481111181 111448181112218181414221111111188128114841814811281111881481111811818288111281 818881118111188288228112218142228118111288128111182441118112888181118111448111 211181111811441488111111188188211888111111288228221111121421111188188111228112 188221811188188188211882828821288112881118181441188111881111828228212111121814 811118111241111411811211128481141221481411111111818118181112181118181888111888 288118411121122828111188181828888411811118221428111111448188221211148421111888 411188181111211411411488111448181111181412111888222181111241184822841111888888 121281841181122181221421218181118118112428881112111421844482118111841111111428 111821421818228111418111188288188188111228118848288114488412118421181188882882 111821818821111888422228112222418181112181488188121411188128118114118888188118 211821441114181888281112241188118111811128228421481128148488418411841128114424 418128441481441424428188421421448118218421411114441188841428288888488188428428 118128128111118411188121218148821188284881118111211888111811881121811888218282 221111881128188212421188428188118111424121828221184241884418111424482118181221 421881811412881121888844811811188128111211811411188118228114221822211228118111 188281188111881441281181128111118188181418118121112148111122111111181118241888 114411181822228828181811822828281812111181128114411411188118181122111288181118 118114418188211821118118114488181121188411411414888188288121188822218822121111 811188181881888181181211818111288111121118288118118418114118181114111111111281 181111218118418111818182181122811418111888812182818418122121118218818888181881 112812881148111818888181822111881181211118282888881111881121148821114421182118 481181881121181118188282412118182218811842842818181812214118118111412248428412 818184118181818181114818184214282811111184111881181221111181181881281222181882 112211881882818811181112211888212221181118881144114414414244281818882884184181 121411182122181114221882884481881418881181122228818811881181182882482882281112 488218112111818814221112111181112214114112181182218414211881881111211144181818 181882282114118881114881881112222211881281182281818414281214184118144211881114 288821818221288412481112181881182881281111182222211281482811814221882111881218 881818881822211882821881112188211111222481121182218182282281128821181141212214 221141821814112284111214424228211218414288814481182181118481181118181844481888 811281111114221811281882881818181118121148841118118214881818881821114411111181 818148142818118818181818181181122221881181144481414184211181114818111111481118 181812214288481122488214488418182282112218111881111181114814411881112882288211 111111818111114211881818882812812111114812118111481881181181181181111881811121 111121118418848111188818182411281214118112884281811881881111212111882111112881 411841881112218184181118118218812211111218142881118882882111211111118211288881 111818121811114111881111121881118888481121422182112218888881111112181114441881 811111811248111181812181881121884211811122111141188114181182188122184128124118 818841112811118141811122814142122882121112142111141811111112818848112181811882 222828818818211212181181181811112118111811112114112118111882811828811811148818 811814184888124888141121111112821811122121111411818811121111118818811218814888 811814888111181111248844828848111221111121141818128888111128821114411141118128 818218211822221111881181888811881112818228884111821818181888811881411811411814 288811411881288882818888811182182222818211814412811888818882882114211828811818 422811881414488221818218811418888418888228181822888818811888182884414411818844 882818881818184811281422884288211184111818881828188211181111812881811222888888 882812221811888881881211882188181811181818188122211881188828184111181814111181 128811888881211211848281181188888818811111818181182112211881122811881281881811 884218288182828888811218811884444884811111881888181888121114412228812482111811 188118411811122882124111111821222828118211118222811211842188148141828822812222 282111818882282184184111288844182128828144818884888188118821118288112144188188 228142118121881282142221818841888142888882814148442821818884224841848211281844 884128828224412228821842111844142282228188888818884218281828821818844124144828 881881844182881211188881281212184118418844448818118288188828148818142112242288 818144881848128122284144121118182188884144142112148818812811888188182142218822 881288144418441188148121184148884144144188842148141211842812188111824188288842 888821888848228122888818848218142148148118118821288128888888121821112144882811 811822188144188111814111818841811118822888821222181288212188811141818888844888 818218128188118118828284288188182228811141122881818828144141822841811288818822 442811222888118812222848821218821122141184181888228188842881842218828824882118 822811211428144144148118842828848818182118842118228288288288122188114141114811 882224144128821181281222818811221148818188884118118148118118818818288188112284 118844142824822448841141822881818888112244821118828112848112181888888181881218 888811822888118114211112884141881818888181811481148118121218181488181112888184 118114188184228841112218118111144488811182228818811288212812881888111228881111 111118288211422211481111418811111188811841118144811111428288821142811111218811 288182181124181124144811148222224112821118181211111128118111118211288818181411 111114441188814182141822818111118118428818818818828218111211118828841181882828 811111118811442111122822128222181282112188111122841112811882241882122882142111 182111144828824188848282142211121141812111221118188121811144111811111111118111 221118222112884181181111111182114811141181128128118214111212111841811811118814 842811828812882181141118148884142212242224811122822211811142181188141188841141 821122142211818112148181812122818128148121811811111111111211122811188111188111 818222828812181844418811818821211114811841211111811841111118844121212181181811 211481188141112811144188112184882888121111811888118142182828111244284114118122 818111822812888488144222888224811184118181122811112288224882211811448111111142 812222812211112111118118811118811128112211118211112118111188218818818128128818 418181211818218181818141882811182818812128821128284221111814811881181181822188 888888181111188188821118188844822888248128111181888818818188111418141112211228 442881212244888111282141821848114118881111482411214128811281184118882812122218 118881828811822112182414482121142822288282418814112828211111411881842848818222 811448118881182881811821881881184418228811888118818218188111182111411414888118 181828822118212222118811181112888181881182111118811128881128211881111881241181 821112828181444828828248222881182121888114218888812881111888111882112888121881 111181141214888881228248221122188218822142288211881111412811841881842812288842 121482111181284244222882111818888214844421442211182828818121181181821141112218 488888118111214424148111188888428811882282188881111812214828188818811188181818 282118811888128118811182188288188111188818111882212288121888811811121118811181 111118111828818181121141128181888811218228881112111112111882811188218111182281 888111122128818818118818188888114148881822228811111181141121811118118812188184 111828118181118818182222841188111882188818811111128141818228811141241881121828 218812211281411188888118418828418121821188112188822211881118288881128824141111 188111811111188218888118221282841812121141812118111811418811288222881188181118 188188821111218822822121481282881288818148111118118818882118811488812182112181 118881888811881182112118818811211118411118121148181811188821412818182411824212 418111811888214848111841111428811288811488811828421288118881822888281448121828 822418121228128884881241288182821228811811841414841244424184848121818818141428 118118218888112118288218111188121188111822122882111811818821118118818224811811 181811888118481182218812221128818181881284212288412884111822888281121821218211 411118112281111481818821811121424481812114181181181811481141882112424412818211 881218112141882282811181412818118122422111882888114888211418218182812811812821 148881211888112118111118118144481828118228148881848888211888218118118288128822 811888181828228211118118181112188821228881118188821188118181818182282111181181 188188811111221111181888188841188842848181122424418442844212112888112211882811 881121888122111828111121228811811111811118218281284224188281111888818888288881 411188111211812111118181218181418811842811118111818118114211411811112882111288 888128812888884188118441811488118111241112281112282888118812281212888112181121 111214112182218184888811181118818141811412812811888114811118124211114422848228 222114411181818888884222118181882811128881188181112188441184482818888188128118 811288118448141882218888888822828881118441182814218811488118814811811118188188 811818811818181818111881888188118181818281228811284188118414118118844118121228 2148184C8881181881111222888888882812221818144881881112288182111182428488141821 812411811841111811182882288818114128881818181811114481418118811818818482288188 1818818414288114282112881124881228288111281188881184118884412882221482211244C8 88111181828881114118184118212111188441141'H } , annot { { data ftable { { data rna { type tRNA , ext tRNA { aa ncbieaa 73 } } , location int { from 0 , to 64 , strand plus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 81 } } , location int { from 89 , to 158 , strand minus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 77 } } , location int { from 161 , to 231 , strand plus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 87 } } , location int { from 1262 , to 1329 , strand plus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 67 } } , location int { from 1337 , to 1401 , strand minus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 89 } } , location int { from 1403 , to 1469 , strand minus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 76 } } , location int { from 3034 , to 3101 , strand plus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 71 } } , location int { from 5615 , to 5679 , strand plus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 65 } } , location int { from 6039 , to 6103 , strand plus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 82 } } , location int { from 6108 , to 6174 , strand plus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 78 } } , location int { from 6193 , to 6258 , strand plus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 83 } } , location int { from 6260 , to 6324 , strand plus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 69 } } , location int { from 6326 , to 6396 , strand plus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 70 } } , location int { from 6401 , to 6464 , strand minus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 72 } } , location int { from 8191 , to 8254 , strand minus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 84 } } , location int { from 9877 , to 9940 , strand plus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 80 } } , location int { from 9941 , to 10003 , strand minus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 83 } } , location int { from 11659 , to 11728 , strand plus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 76 } } , location int { from 12679 , to 12749 , strand minus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 86 } } , location int { from 14072 , to 14141 , strand minus , id local str "66-HSJT" } } , { data cdregion { code { id 5 } } , product whole local str "66-HSJT_1" , location int { from 232 , to 1263 , strand plus , id local str "66-HSJT" } } , { data gene { locus "COX1" } , location int { from 1494 , to 3029 , strand plus , id local str "66-HSJT" } } , { data cdregion { code { id 5 } } , product whole local str "66-HSJT_2" , location int { from 1494 , to 3029 , strand plus , id local str "66-HSJT" } } , { data gene { locus "ATP8" } , location int { from 3996 , to 4154 , strand plus , id local str "66-HSJT" } } , { data cdregion { code { id 5 } } , product whole local str "66-HSJT_3" , location int { from 3996 , to 4154 , strand plus , id local str "66-HSJT" } } , { data gene { locus "ATP6" } , location int { from 4151 , to 4828 , strand plus , id local str "66-HSJT" } } , { data cdregion { code { id 5 } } , product whole local str "66-HSJT_4" , location int { from 4151 , to 4828 , strand plus , id local str "66-HSJT" } } , { data gene { locus "ND3" } , location int { from 5680 , to 6033 , strand plus , id local str "66-HSJT" } } , { data cdregion { code { id 5 } } , product whole local str "66-HSJT_5" , location int { from 5680 , to 6033 , strand plus , id local str "66-HSJT" } } , { data gene { locus "ND5" } , location int { from 6465 , to 8190 , strand minus , id local str "66-HSJT" } } , { data cdregion { code { id 5 } } , comment "TAA stop codon is completed by the addition of 3' A residues to the mRNA" , product whole local str "66-HSJT_6" , location int { from 6465 , to 8190 , strand minus , id local str "66-HSJT" } } , { data gene { locus "ND4" } , location int { from 8262 , to 9599 , strand minus , id local str "66-HSJT" } } , { data cdregion { code { id 5 } } , product whole local str "66-HSJT_7" , location int { from 8262 , to 9599 , strand minus , id local str "66-HSJT" } } , { data gene { locus "ND4L" } , location int { from 9593 , to 9874 , strand plus , id local str "66-HSJT" } } , { data cdregion { code { id 5 } } , product whole local str "66-HSJT_8" , location int { from 9593 , to 9874 , strand minus , id local str "66-HSJT" } } , { data gene { locus "Cyt b" } , location int { from 10509 , to 11645 , strand plus , id local str "66-HSJT" } } , { data cdregion { code { id 5 } } , product whole local str "66-HSJT_9" , location int { from 10509 , to 11645 , strand plus , id local str "66-HSJT" } } , { data gene { locus "ND1" } , location int { from 11747 , to 12676 , strand plus , id local str "66-HSJT" } } , { data cdregion { code { id 5 } } , product whole local str "66-HSJT_10" , location int { from 11747 , to 12676 , strand minus , id local str "66-HSJT" } } , { data rna { type rRNA , ext name "12S ribosomal RNA" } , location int { from 14142 , to 14928 , strand minus , id local str "66-HSJT" } } , { data imp { key "D-loop" } , location int { from 14929 , to 15615 , strand plus , id local str "66-HSJT" } , qual { { qual "allele" , val "control region" } } } , { data gene { locus "ND2" } , location int { from 232 , to 1263 , strand plus , id local str "66-HSJT" } } , { data gene { locus "COX2" } , location int { from 3105 , to 3788 , strand plus , id local str "66-HSJT" } } , { data cdregion { code { id 5 } } , product whole local str "66-HSJT_11" , location int { from 3105 , to 3788 , strand plus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 75 } } , location int { from 3856 , to 3927 , strand plus , id local str "66-HSJT" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 68 } } , location int { from 3929 , to 3995 , strand plus , id local str "66-HSJT" } } , { data gene { locus "ND6" } , location int { from 10006 , to 10509 , strand plus , id local str "66-HSJT" } } , { data cdregion { code { id 5 } } , product whole local str "66-HSJT_12" , location int { from 10006 , to 10509 , strand plus , id local str "66-HSJT" } } , { data rna { type rRNA , ext name "16S ribosomal RNA" } , location int { from 12750 , to 14071 , strand minus , id local str "66-HSJT" } } , { data gene { locus "COX3" } , location int { from 4828 , to 5615 , strand plus , id local str "66-HSJT" } } , { data cdregion { code { id 5 } } , comment "TAA stop codon is completed by the addition of 3' A residues to the mRNA" , product whole local str "66-HSJT_13" , location int { from 4828 , to 5615 , strand plus , id local str "66-HSJT" } } } } } } , seq { id { local str "66-HSJT_1" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 343 , seq-data ncbieaa "MPNNSTKILFLMTLISGTLISLSANSWMGAWMGLEINLLSFIPLLSSNKNMFS TESSLKYFLIQAVASSTILFMILMKINMQELFHFTSNNFWNNIIMLPLLMKMAVAPFHWWLPPVVEGSSWTNCFIILS IQKIAPFTLISYLLSNNLIIQMMIILSALIGAIGGLNQISLRKILAFSSINHIGWMMIMMIMGSNMWILYFTIYTINV SIIILMASILNISFITQTFNPLNNKKLVKFTLLTSMLSLGGLPPFLGFFPKWIAIHFMMQNLLVLSCFILVLSSLLTL YYYLRFMYSTLMITNSENLWFTLIYPKKIIYSNIIMFNLSIILLGMMASTLLLLTY" } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 2" } , desc "ND2" } , location int { from 0 , to 342 , id local str "66-HSJT_1" } } } } } } , seq { id { local str "66-HSJT_2" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 511 , seq-data ncbieaa "MQRWLFSTNHKDIGTLYFVFGAWSGMLGTSLSILIRTELGQPGSLIGDDQIYN VIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSILLLLISSMVESGAGTGWTVYPPLS ASIAHAGPAVDLAIFSLHLAGMSSIMGAVNFITTMINMKPIYMNQTQMPLFIWSVGITALLLLLSLPVLAGAITMLLT DRNLNTSFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHVISHESGKKEAFGNYGMIWAMSAIGFLGFVVWA HHMFTVGMDVDTRAYFTGATMIIAVPTGIKIFSWLATMYGTKVIYTPASLWALGFIFLFTVGGLTGVILANSAIDIIL HDTYYVVAHFHYVLSMGAVFAIMAGFIHWYPLFTGLTLNPNWLKSQFLTMFIGVNLTFFPQHFLGLAGMPRRYSDYPD AYTCWNIVSSMGSMISFIAVIMFIFILWESMSANRPVMFSSQMNSSIEWALNLPPAEHTYNELTLITK" } , annot { { data ftable { { data prot { name { "cytochrome c oxidase subunit I" } , desc "COX1" } , location int { from 0 , to 510 , id local str "66-HSJT_2" } } } } } } , seq { id { local str "66-HSJT_3" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 52 , seq-data ncbieaa "MPQMMPLNWLMLFAFFVMFLFLLNILNYYTVFNKSTSKISQKPGYKTLNWKW" } , annot { { data ftable { { data prot { name { "ATP synthase F0 subunit 8" } , desc "ATP8" } , location int { from 0 , to 51 , id local str "66-HSJT_3" } } } } } } , seq { id { local str "66-HSJT_4" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 225 , seq-data ncbieaa "MTNLFSVFDPSSNIMNLSMNWVSISIGLLLIPMSMWLIPSRNLTLWNLIINKL HEEFKLLIGKKKINKGSTFMFISVLYYILHNNFMGLFPYIFTSTSHMTMTLSLALPLWLSFMIFGWINNTKHMFAHLV PQGTPGPLMPFMVCIETISNMIRPGTLAIRLAANMIAGHLLMTLLGNTGNSMALMIVPFLIFTQILLLTLESAVAMIQ SYVFAVLSTLYSSEVN" } , annot { { data ftable { { data prot { name { "ATP synthase F0 subunit 6" } , desc "ATP6" } , location int { from 0 , to 224 , id local str "66-HSJT_4" } } } } } } , seq { id { local str "66-HSJT_5" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 117 , seq-data ncbieaa "MISLTMTALIITLISFIVMMLSHFLSKKLIESREKSSPFECGFDPMSSSRLPF SLRFFLIAIIFLIFDVEIALLLPISIIPWNSNIMAWSITSITFILILLIGLYHEWNQGSLNWAK" } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 3" } , desc "ND3" } , location int { from 0 , to 116 , id local str "66-HSJT_5" } } } } } } , seq { id { local str "66-HSJT_6" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 575 , seq-data ncbieaa "MMYLSLCFISFFFFMFLSLLSFVLSLYCIMNNMIYFVEWEIVSMNSSSIVMTL LFDWMSLLFMSLVMLISSLVILYSEDYMEGDISLNRFIFLVLLFVLSMMFLVISPNLISILLGWDGLGLISYCLVIYY QNVKSYNAGMLTALSNRIGDVALLMAIAWMVNFGSWNYVNYLNCLFNSIELCVISFLVVLAAMTKSAQIPFSAWLPAA MAAPTPVSALVHSSTLVTAGVYLLIRFSNIFPDWLMKFLLVISVMTMFMSGLGANFEYDLKKIIALSTLSQLGLMMSI LSLGYADLAFFHLLTHALFKALLFMCAGMVIHSVKNFQDIRFMGNLSIFMPLTSSCFMISNFALCGMPFLAGFYSKDM ILEVVSLSNLNMFMFMLYFFSTGLTVCYSFRLFYYVLWGDFNLIPMFKLSEENWMMIYGMLGLMIFAVFGGSFLNWMI FLTPYFICLPLFMKLFPILVSLLGLWLGSILFKYSLSYYFTNFSYYHLVIFFGSMWFMPFIFTKGVSKSFLLLGFNSI KYMDLGWSEYFGPQNLYLLNMKLSSVNQWFQINDFKSYLVIFFISLSLIFLFIV" } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 5" } , desc "ND5" } , location int { from 0 , to 574 , id local str "66-HSJT_6" } } } } } } , seq { id { local str "66-HSJT_7" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 445 , seq-data ncbieaa "MLMCMFYVIFMIPLCFLKNGWWLLQNLMFLISFMYILKVDFFVWSNLSYVFGN DYLSYGLIILSFWICVLMIMASYSVVRYKFYNHLFLFMILLLLLMLYCTFCSSNMIAFYIFFEGSLIPTLFLIYGWGY QPERLQAGMYLLFYTLFASLPLLMGLLYMYNYSYYMFFPLMNMTDYFNLYLYMSMVMAFLVKMPMYLLHLWLPKAHVE APVSGSMILAGVLLKLGGYGLLRVFECLMSIGMNMNVIWMAISLVGGFLVSLMCLRQVDMKALIAYSSVAHMGLVIGG LMTLNSWGMYMSFVLMIAHGLCSSGLFCLANICYERLGSRSLLINKGLLNLMPSMALWWFLLSSSNMAAPPSLNLLGE IGLFNSMIGWMWVVMLFLVLISFFSAAYTLYMYSYSQHGLYYSGMYSSINGYCREYLLLMLHWLPLNLLILKSDFVLI WM" } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 4" } , desc "ND4" } , location int { from 0 , to 444 , id local str "66-HSJT_7" } } } } } } , seq { id { local str "66-HSJT_8" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 93 , seq-data ncbieaa "MLMIFCLMFFCGLWVFCSKRKHLLMTLLSLEFIVLVLFIVLYYYVLMMSGELY VTMVFLSFAVCEGALGLSILVSMIRSHGNDYLNSFGLLQC" } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 4L" } , desc "ND4L" } , location int { from 0 , to 92 , id local str "66-HSJT_8" } } } } } } , seq { id { local str "66-HSJT_9" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 378 , seq-data ncbieaa "MNKPSRKNHPLIKIPNNALVDLPTPSNISSWWNFGSLLGICLLIQILTGLFLA MHYSAHIDLAFSSVAHICRDVNYGWLLRTLHANGASLFFICIYLHIGRGLYYGSYKFYYTWMIGVMILFLVMATAFMG YVLPWGQMSFWGATVITNLLSAIPYLGMELVQWVWGGFAVDNATLNRFFAFHFVLPFIVMAVVMIHLLFLHQTGSNNP LGLNSNIDKIPFHPYFTFKDIFGFIMLLMILCLLSLKEPYILGDPDNFIPANPLITPVHIQPEWYFLFAYAILRSIPN KLGGVIALVMSIAILFFLPLSESNSRGLQYYPINQVMFWMMVMIIILLTWIGARPVEDPYILTGQILTVTYFLYYIFN PLMSKTWDYILYK" } , annot { { data ftable { { data prot { name { "cytochrome b" } , desc "Cyt b" } , location int { from 0 , to 377 , id local str "66-HSJT_9" } } } } } } , seq { id { local str "66-HSJT_10" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 309 , seq-data ncbieaa "MMNFIVLILVSLILIIFVLVGVAFFTLLERKVLGYIHLRKGPNKVGFMGILQP FSDAIKLFCKEHVNPLVSNYLLYYVCPIFSLFLSLLLWMLIPYVSGMFNFNLGLFFFLLCTSMGVYTVMLAGWSSNSN YALLGGLRAVAQTISYEVSLALILLSFVFLISSYSLLDFFYYQVGIWFIFFLFPLCNIWFVSCLAETNRSPFDFAEGE SELVSGFNVEYGSGGFALIFLSEYSSILFMSMMMSIIFMGSDLNSLFFYMKLIFISFLYIWVRGTLPRYRYDKLMFLA WKSFLPISLNFLIFYLGLKIFF" } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 1" } , desc "ND1" } , location int { from 0 , to 308 , id local str "66-HSJT_10" } } } } } } , seq { id { local str "66-HSJT_11" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 227 , seq-data ncbieaa "MATFMSFGLQDSASPLMEQLMYFHDHSMFIITMIVTTVSYMMLSLMTNKFTDR HVMDGQYLEILWTILPAIVLIFIALPSLQILYLIDENSNPTLTLKTIGHQWYWSYEYSDFTDIEFDSYMTPQNEMNNG IRLLEVDNRTTLPMNTLTRILITSEDVIHSWTIPSIGVKADATPGRLNQATFWFNRPGVFYGQCSEICGANHSFMPIV IESVYTNDFLNWILSLSQ" } , annot { { data ftable { { data prot { name { "COX2" } , desc "cytochrome c oxidase subunit II" } , location int { from 0 , to 226 , id local str "66-HSJT_11" } } } } } } , seq { id { local str "66-HSJT_12" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 167 , seq-data ncbieaa "MMYILISMSMALSITFLFLNHPLSMGLILFLQAILMCLISGSMSLSFWFSYIL LLIYLGGMLVLFMYVTSLASNEMFIYSNKMLMTLFFLPMIFITIHYMNMYYPINFYENMENNLIFTTMSNNFLLKMYN QPINLITIMIASYLFLTLIGVVKIIYIYKGPLRQMN" } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 6" } , desc "ND6" } , location int { from 0 , to 166 , id local str "66-HSJT_12" } } } } } } , seq { id { local str "66-HSJT_13" } , descr { molinfo { biomol peptide , tech concept-trans-a } } , inst { repr raw , mol aa , length 262 , seq-data ncbieaa "MTMNTNHPYHLVSYSPWPIVAAMSIMMTMLGYIKYSYEYNEKLMFMGMLMLIL TTIQWWRDVVRESTFQGYHTKEVMTGLRWGMILFIVSEVFFFISFFWTFYHSSLAPAVDLGSSWPPLGIIPFNALQIP LLNTTVLLASGITITWSHHSLMENNYNQAKQGLMLTILLGIYFTSLQLYEYYEAPFTITDSIFGSTFFVATGFHGLHV IIGSTFLFTCLTRMMSMHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGG" } , annot { { data ftable { { data prot { name { "cytochrome c oxidase subunit III" } , desc "COX3" } , location int { from 0 , to 261 , id local str "66-HSJT_13" } } } } } } } } } }