Seq-submit ::= { sub { contact { contact { name name { last "Zhang" , first "Jiayong" , initials "J." } , affil std { affil "College of Chemistry and Life Science, Zhejiang Normal University" , div "Department of Biology" , city "Jinhua" , sub "Zhejiang" , country "China" , street "Yinbin Road No. 688" , email "zhang3599533@163.com" , phone "086-0579-82281811" , postal-code "321004" } } } , cit { authors { names std { { name name { last "Zhang" , first "Jia-Yong" , initials "J.-Y." } } , { name name { last "Yu" , first "Dan-Na" , initials "D.-N." } } } , affil std { affil "College of Chemistry and Life Science, Zhejiang Normal University" , div "Department of Biology" , city "Jinhua" , sub "Zhejiang" , country "China" , street "Yinbin Road No. 688" , postal-code "321004" } } , date std { year 2019 , month 1 , day 14 } } , hup TRUE , reldate std { year 2022 , month 12 , day 31 } , subtype new , tool "tbl2asn 25.6 - MS WINDOWS VISTA" } , data entrys { set { class nuc-prot , descr { source { genome mitochondrion , org { taxname "Pyxicephalus adspersus" , orgname { lineage "Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amphibia; Batrachia; Anura; Neobatrachia; Pyxicephalidae; Pyxicephalinae; Pyxicephalus" , mgcode 2 } } } , pub { pub { gen { cit "Unpublished" , authors { names std { { name name { last "Zhang" , first "Jia-Yong" , initials "J.-Y." } } , { name name { last "Yu" , first "Dan-Na" , initials "D.-N." } } } } , title "The complete mitochondrial genome of Pyxicephalus adspersus with high gene rearrangement" } } } , user { type str "NcbiCleanup" , data { { label str "method" , data str "SequinCleanup" } , { label str "version" , data int 8 } , { label str "month" , data int 4 } , { label str "day" , data int 8 } , { label str "year" , data int 2019 } } } , create-date std { year 2019 , month 1 , day 14 } } , seq-set { seq { id { local str "Pyxicephalus_adspersus" } , descr { title "Pyxicephalus adspersus mitochondrial,complete genome" , molinfo { biomol genomic , tech standard , completeness complete } , user { type str "Submission" , data { { label str "AdditionalComment" , data str "ALT EMAIL:zhang3599533@163.com" } } } , user { type str "Submission" , data { { label str "AdditionalComment" , data str "Submission Title:None" } } } } , inst { repr raw , mol dna , length 24317 , topology circular , strand ds , seq-data ncbi2na '9FF028002DF55E97CA65015DFAE40D42C0276558C9F39C091EB7E C0D221EC8785DC74A9F40108A1F0155177AD5401493DD7C07337E07FCC9F01F02EC99E006708EA 570025708B002BFAD785F1CD07FF7C1F11390B749115B88195F715FF42082896934A4483765461 972FD14455C2ACF492E3313EFCC26127E3F2F0200D225A50DEB949659A7214921D0BE3EF169BC2 6EBC0805DC3C8840460549EC309FB42280044C602F1DC315F8151809CA0101EA3C8C551CE5F94C 03341D1070065EA0F189427C0150287E1AED7351722897BDCC3631D567117453F7EFCD25ECC5D6 D909F14CE0E1F12C25414ADFD450C6D2B42B927CE03AC243A9C43F707C81314067B380449CC0A6 8FCB2C0088324EF7FF0D691CA1BB111656D15DF410155D44F7C3114F0C77208AC2DB04EB0AB1E8 0B91FA0C100CC9F07025DD9F11620CCDEF2148F3FE25F03F25F1D77F339734573D5694C013FF1F DCB0288F0007DC267F2302C590A810E0320380C33C0930009223D576C5FF934EB7272DC7426008 3FCBF85558070B89C750249403A9415377BE4032EA087F22C8AE30971607C80C9EBE5C80083FCB DE5F03F1D3954010DD703F08BCB40C2A127CFE142844173F48AB0105C443C50BA970092517F000 9BC09F27273BF30F43014CB0157518C789055307CEA233CE72072C1080087F7500EC27C05C1E84 251E80F06DCE20CF32C1536720037339471BC17847204FDE808F008808281DA40DF25597BF1400 4D977E703CC22B525E54B840BD06966B15C16E60AC930D1FBDFC0C2872CD0693462A731EDD7F75 0D2E01E3755B8209AA3D073C86208553A27D09500907C7DF4C17701450BCE7CFA7FABEAB859A2C 43305D463B028FD55F3708104BD8205F003B4C038D607D8D06850BC57AA304990D4FD089573610 3ABF185D8EFA34AB35CBAE49671C0AF6FEF418F00571B8DE2F485A24352B6BF737302271572C60 28DAEC93A50E4DDC253315C1C383F37C3CBD04DC41D057014A12F0EC922529CE50257015FFC4AA F40D574F0739F0BF35055F3D573FC4D9573DF3E4B24FDC1DC3E060035CA733104590295C13C6A5 4F68F1D4153678687007FF3C0817359574124DD03DDFCF975505365F0576530DF381577D53551E 47348CC0DF1CF73F35F90DDC97C3BB310FFA9D69EA5D03DC0CE5F0CA25F189EC9501CDDF382F17 C91F3EF7F9D0FF7C9AAA3DD1DDF5FC1FE541044FE3C3FFD05E97FA5F4CE3FD3511C92010162753 F8DC122A60DE07EDD2BFC3BE0C65A2953D97EFFD7E58339C33DC30C0C777710F37DF2BDF4755FD 4F7CD071777CCFC093573CD1FA3F738B599F5C5563D67185074C4DCBF8081FDE5DD15D95C14FF7 1375755375F74F7451470DC82C4D7C1E0B7E0E280883C20575675FC080CA0D81731F088D0075DB 1D574C75D7CB02C270F09FFA95315410EDAF01D7D7F1E3C151C15CF043DCFC975D72B14534573C 27547A73C9783E97E034317C90F3D470C140155455637360964100C7F747424127D7534DF3FD49 F4F067E0142883884E1C97E585542410D7773657CE300F297E555D4FFE0C5E2B0C42835575C129 70F7751384003E450CD7C35F40CD2144F04DCED3C51CFADF1743FE3EAABAA2936440741F6C03CC 93FD3736945EA7830C7CF7C0FF55127C49FD07F378C6D1CC16490CFFFD3C335F919C401F1E0375 175E14005504725704DCC7C57FCD5C9287955DE128FE55C075F3647E078C0100673DF74412F3CC 925D7C72573FFF1759705C743A774479550117507571DD7865F90400C15572F91F3033DF97E325 7747355763DF3DC73223F2BC14854897D02570928BC0575C377B207E4A33C15937DECE41D231FE 0F08C0BDDC8086A5D8D5B001F2F049C0075052627D3DC5D077F0C045F331C0073AC088A1D7177B 7DAA710565971CA717C5EE14D159E3FFF71C34C08CFA4577130DF6A97896832DA4795F2DD74D62 48BC25256915DF288E140DCC1BEFBC49D197DB0C3FFFCCBCC5CC78FA29F6B0787ED57C30FA245E 1324FD764C041389F78F3C595D7DF5D77C9F5DCCBE09EB9E916BE04B71514724A017A5464A57D6 C87E1CFFF47D3766AEFD753DEA25341FCD1073DC0CC0155373C543340451CFEDE35B1C3C792F75 C75DDDD52DF249283C539D7448590DF0C41FDFE15A4A68AA15CD77141173DE3DFEB45482DC4D7C DF14A3FA0F37546CB45F73D01002815FE9C4EACEB3A9CC7743E971EA7F3EDE2745133D1C485F06 C847627C7D13790730D3E535412BB00B3D27876410D46BA8FB40E2095431CE277E9FCDF5DF45BA 9A5E168BED7E40F5D0D86CB1F4E11F3CECBE54FD473BDDD4EA24B3F90D3A6AFDB11E3D55CF45A7 D11F44013A1003D2F6BB0CFECA2C04D17FF54411FDFA9D9E8314658CF58F152197314CE0310FD3 43E9DFC17576C96F3CC30CFCF3788A7FC4940605784B0C813173103BE2E057EAFD5501C5113F82 0524FF430037462028283605D4CD7AFD094844F1477947F7EA0BC7C0411E504A4056727011791F 553A5455BD07E9F5086517554F32081F713FD38D314C32793DF0F2457EFF3334D1057CEDC701DD 091031CF8E742236032DE073CC5263CD78FBCF9DD57475935DC5D32388F2415233C7B0014FA514 38C781F3833D61F7785F0FF874C4C354100DDC814A50F5B7DF82E8C36CC3C550FA049456043CD1 E7861B5C474E05B5515EA2C0248E43D6A58F0141DDFF30F91952BB31C6943BD203FBA2505127F3 943ECB6095D5ED503FFC2781C07C4003974F0807CEC9C5409382E3F03457C3804E5107EEF21538 F5F3FD375DF8B0DFCD13CD0D040BFE0F710F7C1D7D15101380075C4775787F8538430173D050FE 5D54041FE8355F8FF0D94CBFF5F8344FFC156D016783C7059B05D75407EBD74013FDC240DF7E53 C054127440E24FDD73795D31CF5D72B30170CA5D717C44F45507150774F037E97251557387E51E C3C7ADC683417124D5DA5177C520A7453555F3553DC3CD360DCD27C7CF6547247A8B58747943F0 596945FF0F41C3777251749CCF37D343FF37739F1FDD447EF71F1DD7E0367B2730F427C6DFED75 CF097F3F10801133A54501D19FF44CB6350957851F1AA967925FFE7C7DEBFA4138F51FC11073CF 7FF7297C47C47FC1CCF52EB8621BEC620A45C50A13446554B10029719C6930F73F37CD20B3FF7F 3E8FFFE24FF306525C9571FC82CA20EF85551EB34551F055FE0B9475F0C596DF1E977AADD2D178 9D14CB3CC8AB85800997C42571F7043F57297F1F44A5C425322CFD82557D1CF921A0FC681C4F7D B25128FD1A5C46C34DA7573D71C13976765071CC51F47D10451F6BFE0927938C7A4FFB61B6FEBC F5FCEDDCDCF8E2ADF1D5F2C410B12B87D4345C35EB00552888B2445C010FF5433773A4C11115C7 F41155C3F7380041F53807425C21303341F3CEBE1D4C8BF44E5CC7BD34DF7D145B7D7287E5F516 4E45D7F791F739720A0C31C18DF5C25DD5CE14FB7741745D14FCED5575E33C1DCDE5E609E57E9F 3570CB651E46354681E105C005F0175F439C11F31C978B3774D57437E7355470B373896D147110 D7D15D97D775355E8DFFE401FC377F07417D72F8401749D570C35D1F9E1EF577C435E94940B01C 3C38143C36D0644C4FBC3EF73DF43CD0579F9FF9649217DC13FFCDF7D827D5D35411CFCC3C4678 A25420619705929C77F7677311C3E99CD55D7CFE05700F31800CE911FC5D50530175C55011C154 A35C607DDF789C4E41724F5D3C0755F3F13F45FE1D550951BE09D43E4A7730FF24A077DF01DA69 CE835E645D7D7CF42256514102577337E91E90776935C94495D7F971840585E03770F90CD74B49 44E05E3CFBE5BFC179D50E27FF7AA430D30C3E44EBF84DF710CF797240447718191C115910C3ED 759A477C43355DF924DF8E3CFC735C7013267555843C1F412E0F1E38C7E7371878D4FF35FDD72C 95D07C3E51449F31DEC5D778D05418A16F570113C11C5454771158813BDD7057513DD54575D74D 74052078D38CEE0ECBF0C015C8FB8F7203803C3FFD4F4581CB7A2CB881E70F5D18512F43DEE9C8 D0C41F1F775D08C0317151E3F1752FC050CC154C3476EC703F107955105DD670457C1C2455D127 6C095472FE146471740441010650C021F45650004D3E05547BD30CD55115451D79135501F31515 D447855B3FFF1053C1505069554CC7000C07905D30757427D28CA9D671089204309001472CD5D6 2321C00431408C002F154FFE9C9240454154954707355024930CEB868F9094594121108B0000F7 1313CF5E52AB405C870C95800732FB17D0710810E95433C6001515E53C03CD0C1D7FBA17541561 01776938E01F69D5D72897978F91036D129F3F727311C449A1101FA5FF4DEC953379621B41069E 9E35B05D4E506993477FFCDE4DCFD44DA5AADFCF1A77C5DC40805E033EBB6C7DEF5CB8C94493DB 69CEF715E2940CD7DE2A907BCD1C177CDE5955C4DA4481DBD0E0DEA8ABFD2C8419C574763DFC5F 51FED755F65365AC524E3D37DEF5D4501A9D350541E870150172102E53D4C6FF1D7102195CA7D3 4D75DA5D76414DD44F7458171CA2152107FD1494155FB4755544D094838C7DF3D9F190D7DBDCD5 0103CAEBB7C95D95CD0D90FF1E3CE55C1D113701F64570CF5851FDC035FF78D3C3E50C7F8DF04E 0FAAB414B60854F4D90DA10364D497F3F5C37D35D7BD55F70915C80305D7807C00CFC124BE8A1B 73B30C24C4FCCC5533C2151333F4C9307F0ECECF091333B30D44F4DCFC550931771403078CCCF1 C38F05E1420FF02C3BF3C7AF1654CF3871F8DA17D5F9F09F3DB37FD4F3F0D43E7D353514D30503 F0ED1CC7387403830C040F43387BF73B3C9D3C383B34F434F827085C1F00C01C833D7CC1C17EFC 340CD3AC4E7C020C00E3F3550C4FC5C84C0CF7FC7427E03F453421554D14F17EDF850510FAFCA5 3A2F72DF702C5CF308B8490F8E34A2D37868EE0DCE87C1EC30A1137E77F00C5D5D739BC0C5FACC 270851F382D5ADA7ACBF02BAFE4F01F744BAAC3A4CCB4ADEC4FF0E7E413C34938D9FBFBE4FF2D0 E7EF21300F7140FFCE33F5557F42B0D5508D101FFF3000367FFFF7FF9C5555FD5554508BF54C8F 25C1555583CAB738F07FCDFA4BF417B3FCCC0C516C3F546F35288F254CDFF2FC095C84D92C0FFF 85C70F00C04071599FF028002DF55E97CA65015DFAE40D42C0276558C9F39C091EB7EC0D221EC8 785DC74A9F40108A1F0155177AD5401493DD7C07337E07FCC9F01F02EC99E006708EA570025708 B002BFAD785F1CD07FF7C1F11390B749115B88195F715FF42082896934A4483765461972FD1445 5C2ACF492E3313EFCC26127E3F2F0200D225A50DEB949659A7214921D0BE3EF169BC26EBC0805D C3C8840460549EC309FB42280044C602F1DC315F8151809CA0101EA3C8C551CE5F94C03341D107 0065EA0F189427C0150287E1AED7351722897BDCC3631D567117453F7EFCD25ECC5D6D909F14CE 0E1F12C25414ADFD450C6D2B42B927CE03AC243A9C43F707C81314067B380449CC0A68FCB2C008 8324EF7FF0D691CA1BB111656D15DF410155D44F7C3114F0C77208AC2DB04EB0AB1E80B91FA0C1 00CC9F07025DD9F11620CCDEF2148F3FE25F03F25F1D77F339734573D5694C013FF1FDCB0288F0 007DC267F2302C590A810E0320380C33C0930009223D576C5FF934EB7272DC74260083FCBF8555 8070B89C750249403A9415377BE4032EA087F22C8AE30971607C80C9EBE5C80083FCBDE5F03F1D 3954010DD703F08BCB40C2A127CFE142844173F48AB0105C443C50BA970092517F0009BC09F272 73BF30F43014CB0157518C789055307CEA233CE72072C1080087F7500EC27C05C1E84251E80F06 DCE20CF32C1536720037339471BC17847204FDE808F008808281DA40DF25597BF14004D977E703 CC22B525E54B840BD06966B15C16E60AC930D1FBDFC0C2872CD0693462A731EDD7F750D2E01E37 55B8209AA3D073C86208553A27D09500907C7DF4C17701450BCE7CFA7FABEAB859A2C43305D463 B028FD55F3708104BD8205F003B4C038D607D8D06850BC57AA304990D4FD0895736103ABF185D8 EFA34AB35CBAE49671C0AF6FEF418F00571B8DE2F485A24352B6BF737302271572C6028DAEC93A 50E4DDC253315C1C383F37C3CBD04DC41D057014A12F0EC922529CE50257015FFC4AAF40D574F0 739F0BF35054209B97809C285D7E32A21532ABD0155D9F7F03704D040E0700BFF01F11412CD0F0 555D7F1455B0F7CB705C1CC5CF1559D1517175F0E17971C0DF060700FF3526875C7DD5AF2F006A 2095692BB4D79FF66AF90591B9D11D4A9771398AAF2F030C33E5FB62922F9CBE057E45DD4506C8 259340C8BFDC771155FC0397BF18C64AC7C355079245D5B7B6498A7C8F5EC792D1150447082732 9D26125FF09EFCCAE1D65457CBA759515D45013D1E5F9C7DF4C8333A54501D19FF44CB63509578 51F1AA967925FFE7C7DEBF24138F51FC11077CF7FC7297047C47FC1CCF52EB86A13EC620A45C50 A51446554B10029719C6930F73F37CD20B3FF7F368FFFE24FF306525C95717C82CA60EF85D41EB 3C55DF057FE0B9475F0C596DF1E9F5AADD2D1789D14CB3CC8AB85800917C42571F7043F57297F1 F44A5C425722CFF8255FD1CF921A0FC681C4F7DB25128FD1A5C46C34DA7573DF1C1397676507DC 451FC7D90451F6BFE09A7938C784FFB61B6FE3CF5FCEDDCFC78E28DF1FDF2C432C48C1C034DD5D 2805D2880B0E131F7FFDFD3F35F9743DE907BCBF7875574C4548748007B55F1839A7D857F2AD25 67C531D4C63FFDDB253DDFDF7FF87C80D95E75D5455FA96D41D5F55E57C631FE2713C3FCD5F704 FE975DC60E1F42AA7C8389E0C0BDCB70C0843E3F61D0F0F3AFC1D4C81FC7E7DFD55152B032C3FC C5702011C5EDFC70500454CF3F1D173A544157C7B4F7DEE7127D1C3E73CD754F5F05F0F5094FFF BC39C00653D01E5F7C3F771451DF737E9FDF0F4DC7D05251E11E0F85EA143013C1775790FE1771 50437F394365F7FB44E0B37C83FDCDEB3313D215C134173FFC0CDF7CDF5FF2430F35CB7B9280DC FCE77F36AE20AECA0D3B7F7C70FABAC519582439269E499F427BFCC4160FA213EBFCC726F79E3C 7010CCD341413E0FCDD0542055418FBE532B7CF9E49A7900D2443FD1D454E1C9F490C8A95C452F DE5F1D4772C43AFB24A4DC5DF0F64D45438F9770501E57451F977972A94FD0693F9241FB97C150 0E33C000D365F741352507E9F0C32E94FA4D0FF5117A4FFD44FE474E7FFF0A431DF5CE75A4D3CF 441F038E14A33DB08EAAB790C757543C5174EDDD4FAC9F67F0CA0557D724A3DF7702194D3E294C 0C7DFF3C3D0795D77C15CBE5145FC590DC4971BF0DFFF944703FF46360551C173D0600C355DB8F 0D53FF65C90DA893CF9297CF3F380F7DF5030DF3857443141F33C077597C74D1ED1657CD1E5F61 7850070F8D74554100B85B07004F2154CFF30F33CD4591DCB689C7F01D24A0C34D15171C887BFD F110ADA1585FB8037749E5D43439E76069D00297CD01FCDDD75DDF3C5FC57453DF3FC43E38A457 005049701552FD4CFC15069554CC7000C07905D30757427D28CA9D671089204309001472CD5D62 321C00431408C002F154FFE9C9240454154954707355024930CEB868F9094594121108B0000F71 313CF5E52AB405C870C95A001CCBEC5F41C42043A550CF1800545794F00F343075FEE85D505584 05DDA4E3807DA7575CA25E5E3E440DB44A7CFDC9CC47112684407E97FD37B254CDE5886D041A7A 78D6C1753941A64D1DFFF379373F513696AB7F3C69DF17710201780CFAEDB1F7BD72E325124F6D A73BDC578A50335F78AA41EF34705DF3796557136912076F43837AA2AFF4B2106715D1D8F7F17D 47FB5D57D94D96B14938F4DF7BD751406A74D41507A1C05405C840B94F531BFC75C40865729F4D 35D76975D90537513DD1605C728854841FF45250557ED1D5551342520E31F7CF67C6435F6F7354 040F2BAEDF257657343643FC78F395707444DC07D915C33D6147F700D7FDE34F0F9431FE37C138 3EAAD052D82153D36436840D93525FCFD70DF4D75EF557DC2457200C175E01F0033F0492FA286D CECC309313F33154CF08544CCFD324C1FC3B3B3C244CCECC3513D373F15424C5DC500C1E3333C7 0E3C1785083FC0B0EFCF1EBC59533CE1C7E3685F57E7C27CF6CDFF53CFC350F9F4D4D4534C140F C3B4731CE1D00E0C30103D0CE1EFDCECF274F0E0ECD3D0D3E09C21707C0300720CF5F30705FBF0 D0334EB139F00830038FCD54313F17213033DFF1D09F80FD14D085553453C5FB7E141443EBF294 E8BDCB7DC0B173CC22E1243E38D28B4DE1A3B8373A1F07B0C2844DF9DFC0317575CE6F0317EB30 9C2147CE0B56B69EB2FC0AEBF93C07DD12EAB0E9332D2B7B13FC39F904F0D24E367EFEF93FCB43 9FBC84C03DC503FF38CFD555FD0AC3554234407FFCC000D9FFFFDFFE715557F55551422FD5323C 970555560F2ADCE3C1FF37E92FD05ECFF3303145B0FD51BCD4A23C95337FCBF025721364B03FFE 171C3C030101C5640'H } , annot { { data ftable { { data rna { type tRNA , ext tRNA { aa ncbieaa 76 } } , location int { from 0 , to 71 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 84 } } , location int { from 73 , to 142 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 80 } } , location int { from 143 , to 211 , strand minus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 70 } } , location int { from 213 , to 282 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type rRNA , ext name "12S ribosomal RNA" } , location int { from 283 , to 1214 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 86 } } , location int { from 1215 , to 1282 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type rRNA , ext name "16S ribosomal RNA" } , location int { from 1283 , to 2860 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 76 } } , location int { from 2861 , to 2933 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data gene { locus "ND1" } , location int { from 2934 , to 3896 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 81 } } , location int { from 3957 , to 4027 , strand minus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 77 } } , location int { from 4027 , to 4095 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data gene { locus "ND2" } , location int { from 4096 , to 5133 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 87 } } , location int { from 5132 , to 5200 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 65 } } , location int { from 5201 , to 5270 , strand minus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 78 } } , location int { from 5271 , to 5343 , strand minus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 89 } } , location int { from 5383 , to 5449 , strand minus , id local str "Pyxicephalus_adspersus" } } , { data gene { locus "COX1" } , location int { from 5451 , to 6993 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 83 } } , location int { from 6996 , to 7066 , strand minus , id local str "Pyxicephalus_adspersus" } } , { data gene { locus "COX2" } , location int { from 7130 , to 18034 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data gene { locus "ATP8" } , location int { from 7879 , to 8043 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data gene { locus "ATP6" } , location int { from 8034 , to 8715 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data gene { locus "COX3" } , location int { from 8716 , to 9499 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 71 } } , location int { from 9501 , to 9568 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data gene { locus "ND4L" } , location int { from 9719 , to 10006 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data gene { locus "ND4" } , location int { from 10000 , to 11362 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 72 } } , location int { from 11363 , to 11429 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 83 } } , location int { from 11430 , to 11496 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data gene { locus "ND6" } , location int { from 11640 , to 12125 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 69 } } , location int { from 12126 , to 12195 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data gene { locus "cyt b" } , location int { from 12197 , to 13348 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data imp { key "D-loop" } , location int { from 13339 , to 14645 , strand plus , id local str "Pyxicephalus_adspersus" } , qual { { qual "allele" , val "control region 1" } } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 76 } } , location int { from 14646 , to 14717 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 84 } } , location int { from 14719 , to 14788 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 80 } } , location int { from 14789 , to 14857 , strand minus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 70 } } , location int { from 14859 , to 14928 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type rRNA , ext name "12S ribosomal RNA" } , location int { from 14929 , to 15860 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 86 } } , location int { from 15861 , to 15928 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type rRNA , ext name "16S ribosomal RNA" } , location int { from 15929 , to 17506 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 76 } } , location int { from 17507 , to 17579 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 73 } } , location int { from 17602 , to 17672 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 67 } } , location int { from 17892 , to 17956 , strand minus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 68 } } , location int { from 17966 , to 18034 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 75 } } , location int { from 18186 , to 18255 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data gene { locus "COX3" } , location int { from 18310 , to 19093 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data gene { locus "ND3" } , location int { from 19159 , to 19500 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 82 } } , location int { from 19499 , to 19567 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data gene { locus "ND5" } , location int { from 19666 , to 21471 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data rna { type tRNA , ext tRNA { aa ncbieaa 81 } } , location int { from 21796 , to 21866 , strand minus , id local str "Pyxicephalus_adspersus" } } , { data gene { locus "cyt b" } , location int { from 21868 , to 23019 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data imp { key "D-loop" } , comment "D-loop" , location int { from 23020 , to 24316 , strand plus , id local str "Pyxicephalus_adspersus" } , qual { { qual "allele" , val "control region 1" } } } } } } } , seq { id { local str "Pyxicephalus_adspersus_1" } , descr { title "NADH dehydrogenase subunit 1 (mitochondrion) [Pyxicephalus adspersus]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 320 , seq-data ncbieaa "MLKFIQPLIPLFYIAPILIAVAFLTLIERKILGYMQHRKGPNITGPFGLLQPI ADGLKLFIKEPIRPSTASQILFIASPTIALTLAMILWTPLPIPTALSDMNLTILFILAISSLNVYTILGSGWASNSKY ALMGALRAVAQTISYEVTLALIVLCSIFLAGGFSLSSFNFAQQHIWLIFSTWPLAFMWFSSTLAETNRAPFDLTEGES ELVSGFNVEYAGGPFALFFLAEYANILMMNTLSTIIFLGSSLPFPFLSTTSLMFKASLLSLGFLWVRASYPRFRYDQL MHLVWKNFLPLTLALTIFYISLPISFSFSPPLI" } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 1" } } , location int { from 0 , to 319 , id local str "Pyxicephalus_adspersus_1" } } } } } } , seq { id { local str "Pyxicephalus_adspersus_2" } , descr { title "NADH dehydrogenase subunit 2 (mitochondrion) [Pyxicephalus adspersus]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 345 , seq-data ncbieaa "MNPLTLLTILFSLLLGTTITLLSSHWLLAWIGLEINTLAIIPLMTKTPHPRSI EAATKYFLTQATASSIILFSSFINAWNQGEWDMTSLADPQATILSIALMMKLGLAPLHFWMPEVMQGIPLLTGLILST WQKIAPMSLILQMSDHINIYVITTIGLTSILIGGWGGIAQTQLRKIMAFSSIGHLGWMMLILKFSPQLTAFNFIWYVT MTAAMFFSLMSLHATKLTEISTSWPKTPTLALTSMLTLLSLAGLPPLTGFAPKLLIALELMKQNAILLTTVIMAASLL ALFFYLRLTYSMALTLPPNTSNSLLSWRLATKMTPLVALMNILALMALSLSPSILILL" } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 2" } } , location int { from 0 , to 344 , id local str "Pyxicephalus_adspersus_2" } } } } } } , seq { id { local str "Pyxicephalus_adspersus_3" } , descr { title "cytochrome c oxidase subunit I (mitochondrion) [Pyxicephalus adspersus]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 514 , seq-data ncbieaa "MTITRWFFSTNHKDIGTLYMIFGAWAGMVGTALSLLIRAELSQPGTLLGDDQI YNVVVTAHAFVMIFFMVMPMLIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFFLLLASSMVEAGAGTGWTVYPP LAGNLAHAGPSVDLTIFSLHLAGVSSILGAINFITTILNMKPPSITQYQTPLFVWSVLITAVLLLLSLPVLAAGITML LTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGIISHVVTFYSNKKEPFGYMGMVWAMLSIGLLGFIV WAHHMFTTDLNVDTRAYFTSATMIIAIPTGVKVFSWLATIHGGIVKWEAPMLWALGFIFLFTVGGLTGVVLANSSIDV VLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLFTGFTLHKTWTKIQFGVMFVGVNITFFPQHFLGLAGMPRRYSDY PDAYTMWNTISSIGSLTSLVAVIMMMFIIWEAFTAKRTLTVMEHTYTNVEWTLGFPPNYHTFEEPAFSMKI" } , annot { { data ftable { { data prot { name { "cytochrome c oxidase subunit I" } } , location int { from 0 , to 513 , id local str "Pyxicephalus_adspersus_3" } } } } } } , seq { id { local str "Pyxicephalus_adspersus_4" } , descr { title "cytochrome c oxidase subunit II (mitochondrion) [Pyxicephalus adspersus]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 229 , seq-data ncbieaa "MAHPVQLGFQDATSPIMEELLHFHDHTMMAAFLISTLVLYIITTLMSTKLSST NTIDAQEIEMVWTIMPAIILIVIALPSLRILYLMDEISNPDITVKTIGHQWYWTYEYSDFSDLNFDSYMIPTKSLEPG QFRLLEVDNRMITPIGTATRTIITADDVLHSWTVPTLGVKADAIPGRLNQLSFMIARPGVYYGQCSEICGANHSFMPI VVEALPVPNFLSWTKLTKNA" } , annot { { data ftable { { data prot { name { "cytochrome c oxidase subunit II" } } , location int { from 0 , to 228 , id local str "Pyxicephalus_adspersus_4" } } } } } } , seq { id { local str "Pyxicephalus_adspersus_5" } , descr { title "ATP synthase F0 subunit 8 (mitochondrion) [Pyxicephalus adspersus]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 54 , seq-data ncbieaa "MPQLVLDPWFLIFISSWVIFITLSINKVLNSTILNSFTHKHEKLLHSPWLWPW Q" } , annot { { data ftable { { data prot { name { "ATP synthase F0 subunit 8" } } , location int { from 0 , to 53 , id local str "Pyxicephalus_adspersus_5" } } } } } } , seq { id { local str "Pyxicephalus_adspersus_6" } , descr { title "ATP synthase F0 subunit 6 (mitochondrion) [Pyxicephalus adspersus]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 227 , seq-data ncbieaa "MTMNLFNQFASPNNFGIPLILIAMVFPWITFLTPSNRWITNRVTSSQTWFLKT FSKQIFLPLNPTAHKWAFLLSALMLFLLGMNLMGLLPYTFTPTTQLSLNLGLATPLWLATVITGLRNQPTASLGHLLP EGSPSPLIPILIIIESISLLIRPLALGVRLTANLTAGHLLIQLISLATSAMLSSSIFISMLTFSTLVLLTLLEIAVAM IQAYVFVLLLSLYLQENT" } , annot { { data ftable { { data prot { name { "ATP synthase F0 subunit 6" } } , location int { from 0 , to 226 , id local str "Pyxicephalus_adspersus_6" } } } } } } , seq { id { local str "Pyxicephalus_adspersus_7" } , descr { title "cytochrome c oxidase subunit III (mitochondrion) [Pyxicephalus adspersus]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 261 , seq-data ncbieaa "MAHQTHAFHMVDPSPWPLTGAAAAFLLTSGLATWFHFNTTIILFLGLTLTLLT MFQWWRDVVREGTYQGHHTPPVQKGLRYGMILFILSEVFFFIGFFWAFYNASLAPTLEVGECWPPTGITPLNPFEVPL LNTAVLLASGVSVTWAHHSIMEGDRKSALQALLLTISLGLYFTGLQAMEYFEAPFTIADGIYGTTFFVATGFHGLHVI IGSLFLLTCLARQLLYHFTSQHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS" } , annot { { data ftable { { data prot { name { "cytochrome c oxidase subunit III" } } , location int { from 0 , to 260 , id local str "Pyxicephalus_adspersus_7" } } } } } } , seq { id { local str "Pyxicephalus_adspersus_8" } , descr { title "NADH dehydrogenase subunit 4L (mitochondrion) [Pyxicephalus adspersus]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 95 , seq-data ncbieaa "MPMLFIIFFTTVFLGLAFHRMHLLSALLCLEGMMLTIFLSLSLWPLSLNLTSP FMSPLLMLTLSACEAALGLSLMVATARSHGTDNLKTLNLLQC" } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 4L" } } , location int { from 0 , to 94 , id local str "Pyxicephalus_adspersus_8" } } } } } } , seq { id { local str "Pyxicephalus_adspersus_9" } , descr { title "NADH dehydrogenase subunit 4 (mitochondrion) [Pyxicephalus adspersus]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 454 , seq-data ncbieaa "MLTLMLAWVSLIPSILLSPTKYLWAVTTTQSFTLAFLSIPWIFLQNFNLFNST FLVDKTSAPLMILTCWLFPLTILASQSKLINEPINRQRTYIVNCSILQLSTLLAFAAADLLTFFIFFEASLIPTLFMI TRWGAQERRLTAGYSFSLYTLIGAIPLLIWTLKLYEKYGTLYLPTMNLLPQTLTPGSYELLFWATCNLAFLIKLPLFT FHLWLPQAHVEAPIAGSMILAGTLLKLGGYGILRTSFLIQEPATNKALYILALATLGILATALLCLRQTDLKSLIAMS SVSHMNLIIVAVLTCSQWAFSGAMIMMIAHGLTSSTMFCLANTLYERTNTRTMIVLRGTLTMSPLAASWWLFTILLNM ALPPTINFNSELLMMLAIYDWSILSFLLVALNLIATTAYTLYLLWSTQRGPFPKHINTTHPLYTREHVLLTLHILPTL LLILKPELIMM" } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 4" } } , location int { from 0 , to 453 , id local str "Pyxicephalus_adspersus_9" } } } } } } , seq { id { local str "Pyxicephalus_adspersus_10" } , descr { title "NADH dehydrogenase subunit 6 (mitochondrion) [Pyxicephalus adspersus]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 161 , seq-data ncbieaa "MYVEFFLLLCLLAVACNPSPYYAALGMVSGAGVGCLLLAKNGVTFLSLVLFLV YLGGMLVVFAYCSALVAEPYPEAWGSYEVAVYFLVYGGPLVGLMVVKKYGVSVEGGYKFGDVQEWWGVGDIMNSGGSM MFFGGWSLLLALFVVFEVVRGQTSGALRAV" } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 6" } } , location int { from 0 , to 160 , id local str "Pyxicephalus_adspersus_10" } } } } } } , seq { id { local str "Pyxicephalus_adspersus_11" } , descr { title "cytochrome b (mitochondrion) [Pyxicephalus adspersus]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 383 , seq-data ncbieaa "MAPMLRKTHPAIKIINNSFVDLPTPTNLSAWWNFGSLLGACLIAQIVTGLFLA MHYTADTNLAFSSVAHICRDVNNGWLIRNLHANGASLFFICIYFHIGRGLYYGSYLYKETWNIGVVLLFLVMATAFVG YVLPWGQMSFWGATVITNLLSAAPYIGTELVQWIWGGFSVDNATLTRFFTFHFVLPFAIAGTSMIHLLFLHQTGSSNP TGLNPNLDKVPFHTFYSYKDALGFIILLGLLATISTFSPNLLGDPDNFSPANPLVTPPHIKPEWYFLFAYAILRSIPN KLGGVLALALSIAILLIMPLTHTSKLRTLMFRPLSKILFWSLIANTLILTWIGGQPVEDPFIAIGQIASSLYFLIFIL LFPLLSTLENNLLKLKNI" } , annot { { data ftable { { data prot { name { "cytochrome b" } } , location int { from 0 , to 382 , id local str "Pyxicephalus_adspersus_11" } } } } } } , seq { id { local str "Pyxicephalus_adspersus_12" } , descr { title "cytochrome c oxidase subunit III (mitochondrion) [Pyxicephalus adspersus]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 261 , seq-data ncbieaa "MAHQTHAFHMVDPSPWPLTGAAAAFLLTSGLATWFHFNTTLILLLGLTLTLLT MFQWWRDIVREGTYQGHHTPPVQKGLRYGMILFILSEVFFFIGFFWAFYNASLAPTLEVGECWPPTGITPLNPFEVPL LNTAVLLASGVSVTWAHHSIMEGDRKSTLQALLLTISLGLYFTGLQALEYFEAPFTIADGIYGTTFFVATGFHGLHVI IGSLFLLTCLARQLLHHFTSQHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS" } , annot { { data ftable { { data prot { name { "cytochrome c oxidase subunit III" } } , location int { from 0 , to 260 , id local str "Pyxicephalus_adspersus_12" } } } } } } , seq { id { local str "Pyxicephalus_adspersus_13" } , descr { title "NADH dehydrogenase subunit 3 (mitochondrion) [Pyxicephalus adspersus]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 113 , seq-data ncbieaa "MTYFFFLSFILASILATVSFWLPLMHPDSEKLSPYECGFDPLGSARLPYSMRF FLVAILFLLFDLEIALLLPTPWAVQLPSPALTMLWATLILSLLTFGLLYEWLQGGLEWAE" } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 3" } } , location int { from 0 , to 112 , id local str "Pyxicephalus_adspersus_13" } } } } } } , seq { id { local str "Pyxicephalus_adspersus_14" } , descr { title "NADH dehydrogenase subunit 5 (mitochondrion) [Pyxicephalus adspersus]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 601 , seq-data ncbieaa "MAHNPLLSFFCATASLIAIILPFLNLNSKPFFVNAKNAIQTAFLISLPPLFYL GFLNSSTSTSHWHWIDLGPMNINLSLQFDLYPTIFMPIAFFVTWSILEFSIWYMHSDPNINLFFKYLLIFLLAMIILV CAGNLFMLFIGWEGVGIMSFLLIGWYHARSNAAAAALQAVLYNRIGDIGFMLAFCWLLNNMSSTNIEFISTQEPPTIV AMGLIAAAAAKSAQFSLHPWLASAMEGPTPVSALLHSSTMVVAGIYLLIRIHPMIASNQTALTTCLCLGAISTAFAAT CALTQNDIKKIIAFSTSSQLGLMMVAIGINFPHLAFFHICTHAFFKAMLFLCSGIIIHNLNDDQDIRKMGGLQYSLPI TTSCLSIGSFALMGTPFLAGFFSKDAIIEAMNTSFINSTALLLTLVATTFTAIYSLRLIFFATLNFSRSNPTNLFNEN NPLVINPIFRLAIGSIIAGLIIYEILLPNNLMTLTMPTYIKLSALLITVTALITAFDLTKTNWSSPPTKVTVTKTLDP MFYNYIIHRTLVGATLNSAGMIITHLLETVFLHKVGPDLVKISQLPPINAARTAQKGLIKLYLSSSLITFTLTILILQ LM" } , annot { { data ftable { { data prot { name { "NADH dehydrogenase subunit 5" } } , location int { from 0 , to 600 , id local str "Pyxicephalus_adspersus_14" } } } } } } , seq { id { local str "Pyxicephalus_adspersus_15" } , descr { title "cytochrome b (mitochondrion) [Pyxicephalus adspersus]" , molinfo { biomol peptide , tech concept-trans } } , inst { repr raw , mol aa , length 383 , seq-data ncbieaa "MAPMLRKTHPAIKIINNSFVDLPTPTNLSAWWNFGSLLGACLIAQIVTGLFLA MHYTADTNLAFSSVAHICRDVNNGWLIRNLHANGASLFFICIYFHIGRGLYYGSYLYKETWNIGVVLLFLVMATAFVG YVLPWGQMSFWGATVITNLLSAAPYIGTELVQWIWGGFSVDNATLTRFFTFHFVLPFAIAGTSMIHLLFLHQTGSSNP TGLNPNLDKVPFHTFYSYKDALGFIILLGLLATISTFSPNLLGDPDNFSPANPLVTPPHIKPEWYFLFAYAILRSIPN KLGGVLALALSIAILLIMPLTHTSKLRTLMFRPLSKILFWSLIANTLILTWIGGQPVEDPFIAIGQIASSLYFLIFIL LFPLLSTLENNLLKLKNI" } , annot { { data ftable { { data prot { name { "cytochrome b" } } , location int { from 0 , to 382 , id local str "Pyxicephalus_adspersus_15" } } } } } } } , annot { { data ftable { { data cdregion { frame one , code { id 2 } } , product whole local str "Pyxicephalus_adspersus_1" , location int { from 2934 , to 3896 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data cdregion { frame one , code { id 2 } } , product whole local str "Pyxicephalus_adspersus_2" , location int { from 4096 , to 5133 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data cdregion { frame one , code { id 2 } } , comment "TAA stop codon is completed by the addition of 3' A residues to the mRNA" , product whole local str "Pyxicephalus_adspersus_3" , location int { from 5451 , to 6993 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data cdregion { frame one , code { id 2 } } , comment "TAA stop codon is completed by the addition of 3' A residues to the mRNA" , product whole local str "Pyxicephalus_adspersus_4" , location int { from 7130 , to 7817 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data cdregion { frame one , code { id 2 } } , product whole local str "Pyxicephalus_adspersus_5" , location int { from 7879 , to 8043 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data cdregion { frame one , code { id 2 } } , comment "TAA stop codon is completed by the addition of 3' A residues to the mRNA" , product whole local str "Pyxicephalus_adspersus_6" , location int { from 8034 , to 8715 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data cdregion { frame one , code { id 2 } } , comment "TAA stop codon is completed by the addition of 3' A residues to the mRNA" , product whole local str "Pyxicephalus_adspersus_7" , location int { from 8716 , to 9499 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data cdregion { frame one , code { id 2 } } , product whole local str "Pyxicephalus_adspersus_8" , location int { from 9719 , to 10006 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data cdregion { frame one , code { id 2 } } , comment "TAA stop codon is completed by the addition of 3' A residues to the mRNA" , product whole local str "Pyxicephalus_adspersus_9" , location int { from 10000 , to 11362 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data cdregion { frame one , code { id 2 } } , product whole local str "Pyxicephalus_adspersus_10" , location int { from 11640 , to 12125 , strand minus , id local str "Pyxicephalus_adspersus" } } , { data cdregion { frame one , code { id 2 } } , product whole local str "Pyxicephalus_adspersus_11" , location int { from 12197 , to 13348 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data cdregion { frame one , code { id 2 } } , comment "TAA stop codon is completed by the addition of 3' A residues to the mRNA" , product whole local str "Pyxicephalus_adspersus_12" , location int { from 18310 , to 19093 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data cdregion { frame one , code { id 2 } } , product whole local str "Pyxicephalus_adspersus_13" , location int { from 19159 , to 19500 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data cdregion { frame one , code { id 2 } } , product whole local str "Pyxicephalus_adspersus_14" , location int { from 19666 , to 21471 , strand plus , id local str "Pyxicephalus_adspersus" } } , { data cdregion { frame one , code { id 2 } } , product whole local str "Pyxicephalus_adspersus_15" , location int { from 21868 , to 23019 , strand plus , id local str "Pyxicephalus_adspersus" } } } } } } } }